Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01570-AT4G00300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF604)
Function (paralog2):fringe-related protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.1731421729651
Log2 mRNA fold difference:4.4744984890144
Log2 TE fold difference:-0.36167023912825
Sequences
Protein sequence

MSRLIFLILAILFSLQFVFYPLNFISSSSQPLIKFSVSPVVSGSGSVHEPDQTELKHVVF
GIAASAKFWKHRKDYVKLWWKPNGEMNGVVWLDQHINQNDNVSKTLPPIRISSDTSRFQY
RYPKGLRSAIRITRIVSETVRLLNGTELEKNVRWIVMGDDDTVFFPENLVKVLRKYDHNQ
FYYIGSSSESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSELYGSDDRIH
ACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLVDPVFPNMGRVNAMR
RFMVPAKLDSPSLAQQSICYDADHRWTVSVSWGYTVQIIRGVLSAREMVIPTRTFIDWYK
QADERSYAFNTRPIAKSACQRPRVYYLSNALPDLALRRTASEYVRWYDMWEPECDWDMSD
PSEFERVIVYKKPDPDRWNKHRAPRRDCCRVLPTTKNGTMVIDVGACKDDEFAEFLVK

MGDQKTLSYDKSNKPFYSSSSSPCSFTAIVVFLIFVSYLLYSFSFISFLNPYSPSKSPNS
LLVPVIRLGSGQTPEEQTELKHIVFGIAASSDLWKHRREYVKTWWKPNGVMNGAVWLDKP
INDTVSSSSALPQIRISSDTSSFKYRYRNGHRSAIRITRIVSETVRMLNGTEAERNVRWV
VMGDDDTVFFTENLVRVLRKYDHKQFYYIGAPSESHLQNLHQFSYGMAYGGGGFAISYPL
AKVLEKMQDRCIERYSDLYGSDDRIHACMAELGVPLTKEVGFHQFDVYGNLLGLLSVHPQ
APIVSIHHLDVVDPIFPKTNRVNALKKLMIPAKLDSASLVQQSVCYDKSHQWTMSISWGY
TVQITRTYMPARMMEVPTRTFNDWHLRSDFTNLAFNTRPVTWTDCQRPRVFYFSHAFSNS
SSSDTTTISQYLRHDEWYPKCEWGIADPSEINQIFVYKKPTPDRWSKVVIRFVPSKDSNF
AFVNAIEVISAPKDLIGDVATSVSHDGTEKFNGLAKQAMEVVYRVNVGGRKVTPFNDTLW
RTWVTDEGFLKTGDGSSEKSYFTGRIKYRRGGASREVGPDNVYNTARVGKRSNGLVDMSW
GFKVNVGYKYLIRMHFCDIASKSLGRLYFNVYINGNLAYEDFDISYAADNVLASPYYIDF
VVDATADDNNPSGSSITVSVGPSNKTSVDGNGVDAILNGVEIMKMNNSMGSLDGYVSTEM
ILSTCPNRRNLSIFIAMLAFMCIFMSFYIVTQRKRVKDQYGWTKLSMDVLEDNSKSGNQF
TARKA

Other information
Ka divergence:0.156815KaKs divergence:-0.97693
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):1437Length 2 (bp):2358Length divergence:0.243
MFE 1 (kcal):-463.9MFE 2 (kcal):-725.9MFE divergence0.22