Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01600-AT4G00360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 86, subfamily A, polypeptide 4
Function (paralog2):cytochrome P450, family 86, subfamily A, polypeptide 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:5.1731943038619
Log2 mRNA fold difference:5.0676280970261
Log2 TE fold difference:0.065308682183755
Sequences
Protein sequence

MEISNAMLLVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRAC
GGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF
NSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILATAQDNAEPVDLQDLIL
RLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFIIPKFMWKLKKWLGLGL
EVSLSRSLGEIDEYLAAVINTRKQELMSQQESGTHQRHDDLLSRFMMKKTESYSDTFLQH
VALNFILAGRDTSSVALSWFFWLITMHPTVEDKIVREICSVLIETRGTDDVASWTEEPLG
FDEIDRLVYLKAAISETLRLYPSVPEDSKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMK
STWGEDCLEFNPERWISPIDGKFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLL
RHRLTVVPGHKVEQKMSLTLFMKNGLLVNLYKRDLQGIIKSLVVKKSDGVSNGQCNGVIG
EGVAVYLNTGVAVV

MDVSNTMLLVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC
GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF
NSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILETAQNNYEPVDLQDLIL
RLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFILPEFLWRLKKWLGLGL
EVSLSRSLGEIDGYLDAVINTRKQELLSQRESGVQRHDDLLSRFMKKKDQSYSETFLRHV
ALNFILAGRDTSSVALSWFFWLITTHPTVEDKIVREICSVLIETRGTDVSSWTAEPLEFD
EVDRLVYLKAALSETLRLYPSVPEDSKHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKST
WGEDCLEFKPERWISPDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRH
RLTVAPGHKVEQKMSLTLFMKNGLLVNVHKRDLEVMMKSLVPKERNDVVVLNGKCNGGIG
EGVAVNAAVAVAV

www.000webhost.com

Other information
Ka divergence:-0.0102974KaKs divergence:0.389585
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):1665Length 2 (bp):1662Length divergence:-0.001
MFE 1 (kcal):-588.33MFE 2 (kcal):-613.34MFE divergence0.021