Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01610-AT4G00400
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycerol-3-phosphate acyltransferase 4
Function (paralog2):glycerol-3-phosphate acyltransferase 8

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.0746908561606
Log2 mRNA fold difference:-2.6275197812694
Log2 TE fold difference:0.59347644199405
Sequences
Protein sequence

MSPAKKSRSFPPISECKSREYDSIAADLDGTLLLSRSSFPYFMLVAIEAGSLFRGLILLL
SLPIVIIAYLFVSESLGIQILIFISFAGIKIKNIELVSRAVLTRFYAADVRKDSFEVFDK
CKKRKVVVTANPIVMVEPFVKDYLGGDKVLGTEIEVNPKTMKATGFVKKPGVLVGDLKRL
AILKEFGDDSPDLGLGDRTSDHDFMSICKEGYMVHETKSATTVPIESLKNRIIFHDGRLV
QRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTYEILGIHLTIRGHRPPPPSP
GKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSLMLSPIPAVALTRDRVADAAR
MRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKF
WDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEVANYVQKVIGGVLGFECTELTRK
DKYLLLGGNDGKVESINKTKSME

MSPEKKSQNFPPITECRDGEYDSIAADLDGTLLLSRSSFPYFMLVAVEAGSLLRGLILLL
SLPFVIISYLFVSESLGIQILIFISFAGLKIRDIELVSRAVLPRFYAADVRKDSFEVFDK
CKRKVVVTANPIVMVEAFVKDYLGGDKVLGTEIEVNPKTNRATGFVKKPGVLVGDLKRLA
ILKEFGNESPDLGLGDRTSDHDFMSLCKKGYMVHATKSATTIPKERLKNRIVFHDGRLAQ
RPTPLNAIITYLWLPFGFILSIIRVYFNLPLPERFVRYTYEMLGIHLTIRGHRPPPPSPG
TLGNLYVLNHRTALDPIIVAIALGRKICCVTYSVSRLSLMLSPIPAVALTRDRATDAANM
RKLLEKGDLVICPEGTTCREEYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFW
DPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPIEVANYVQKVIGAVLGFECTELTRKD
KYLLLGGNDGKVESINNTKK

www.000webhost.com

Other information
Ka divergence:0.102424KaKs divergence:-0.437909
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):1512Length 2 (bp):1503Length divergence:-0.003
MFE 1 (kcal):-477.49MFE 2 (kcal):-457.43MFE divergence-0.021