Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01620-AT4G00430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasma membrane intrinsic protein 1C
Function (paralog2):plasma membrane intrinsic protein 1;4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.2264640706437
Log2 mRNA fold difference:-0.29368083863752
Log2 TE fold difference:0.056443697390846
Sequences
Protein sequence

MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPFFEPGELSSWSFYRAGIAEFIA
TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGA
EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL
GAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIPFKSRS

MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI
ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG
AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS
LGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKSKS

www.000webhost.com

Other information
Ka divergence:-0.285259KaKs divergence:0.121951
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):861Length 2 (bp):864Length divergence:0.002
MFE 1 (kcal):-311.5MFE 2 (kcal):-287.8MFE divergence-0.04