Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01740-AT4G00710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with tetratricopeptide repeat domain
Function (paralog2):BR-signaling kinase 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.0005089898925
Log2 mRNA fold difference:3.9090587562345
Log2 TE fold difference:0.25773752027176
Sequences
Protein sequence

MGGQSSKIGTCCSHKTTALEAPDVENKENGEVNGVHSFREYSLEQLKIATSCFALENVVS
EHGETAPNVVYQGKLENHMKIAIKRFSGTAWPDPRQFLEEARLVGQLRSKRMANLLGYCC
EGGERLLVAEFMPNETLAKHLFHWDTEPMKWAMRLRVALYISEALEYCSNNGHTLYHDLN
AYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRITAESVIYSFGTLLL
DLLTGKHIPPSHALDLIRDRNLQTLTDSCLEGQFSDSDGTELVRLTSCCLQYEARERPNI
KSLVTALISLQKDTEVLSHVLMGLPQSGTFASPPSPFAEACSGKDLTSMVEILEKIGYKD
DEDLSFMWTEQMQEAINSKKKGDIAFRRKDFSEAIEFYTQFLDLGMISATVLVRRSQSYL
MSNMAKEALDDAMKAQGISPVWYVALYLQSAALSVLGMEKESQIALTEGSILEARKISAS
TQN

MGGQCSSLSCCRNTSHKTAVLEAPDVDNGESSEITDVPNFREYTLEQLKAATSGFAVEYI
VSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDSRQFLEEARSVGQLRSERMANLLGC
CCEGDERLLVAEFMPNETLAKHLFHWETQPMKWTMRLRVVLYLAQALEYCTSKGRTLYHD
LNAYRVLFDEECNPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRITPESVIYSFGTL
LLDLLSGKHIPPSHALDLIRDRNLQTLTDSCLDGQFSDSDGTELVRLASRCLQYEARERP
NTKSLVTALTPLQKETEVLSHVLMGLPHSGSVSPLSPLGEACSRRDLTAMLEILEKLGYK
DDEGVTNELSFHMWTDQMQESLNSKKKGDVAFRQKDFREAIECYTQFIDGGMISPTVCAR
RSLCYLMSDMPKEALDDAIQAQVISPVWHVASYLQSASLGILGMEKESQIALKEGSNLEA
KMNGVPRVK

Other information
Ka divergence:-0.523611KaKs divergence:-0.452064
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1452Length 2 (bp):1470Length divergence:0.006
MFE 1 (kcal):-427.7MFE 2 (kcal):-461.36MFE divergence0.038