Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01750-AT4G00680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin depolymerizing factor 11
Function (paralog2):actin depolymerizing factor 8

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.80578632669602
Log2 mRNA fold difference:-0.48179595251049
Log2 TE fold difference:1.1660449750129
Sequences
Protein sequence

MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSI
PEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE
LQATDPSEMSLDIIKGRVNL

MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSI
PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE
LQATDPSEMSLDIIKGRLNL

www.000webhost.com

Other information
Ka divergence:0.339358KaKs divergence:-0.999869
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):423Length 2 (bp):423Length divergence:0
MFE 1 (kcal):-109.7MFE 2 (kcal):-99.3MFE divergence-0.05