Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G01790-AT4G00630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):K+ efflux antiporter 1
Function (paralog2):K+ efflux antiporter 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0723647784985
Log2 mRNA fold difference:-1.3783697983318
Log2 TE fold difference:0.32504534074852
Sequences
Protein sequence

MEYASTFQRPILFHGGDGASYCFPNRLISPKGISITSGDSKVHSCFRLRRNVAQSGTLNL
MNACFSGRFYSGHLHSTKSILGNGHQAKRIPFGFRLRCQGHESLGNADSNDHRIGESSES
SDETEATDLKDARVENDTDSLEELKELLHKAIKELEVARLNSTMFEEKAQRISERAIALK
DEAATAWLDVNKTLDVIRDTVYEEALAKEAVQTATMALSLAEARLQVIVESLEAGAGNDI
PHVSEETEETIDVNDKEEALLAAKDDIKECQVNLDNCESQLSALLSKKDELQKEVDKLNE
FAETIQISSLKAEEDVTNIMKLAEQAVAFELEATQRVNDAEIALQRAEKSLSISQTPEET
QGQLSDEETSQEDAMVLSGNVEDVTHQVEKESPKDGDLPVVQITAELVPDIVGQRNKKLT
QPYESSDHENGKPSVESSKVVEADSEKPKINVQTKKQETQKDLPKEGSSLNSPKASFNKS
SRFFSASFFSSNPDGTATVFGSLVGSVKQQWPKLVLGLALLGAGLTLYSNGVGGNNQLLQ
QPDVTSTSTEDVSSSTKPLIRQVQKLPKRIKKLLEMIPHQEVNEEEASLFDFLWLLLASV
IFVPLFQKIPGGSPVLGYLAAGILIGPYGLSIIRNVHGTRAIAEFGVVFLLFNIGLELSV
ERLSSMKKYVFGLGSAQVLVTAAVVGLLAHYVAGQAGPAAIVIGNGLALSSTAVVLQVLQ
ERGESTSRHGRASFSVLLFQDLAVVVLLILIPLISPNSSKGGIGFQAIAEALGLAAVKAA
VAITAIIAGGRLLLRPIYKQIAENRNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAG
LLLAETEFSLQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLSNFPVIVGTLGLLIVGKTM
LVVIMGKLFGISIISAIRVGLLLAPGGEFAFVAFGEAVNQGIMSPQLSSLLFLVVGISMA
ITPWLAAGGQLIASRFELHDVRSLLPVESETDDLQGHIIICGFGRVGQIIAQLLSERLIP
FVALDVSSDRVTIGRSLDLPVYFGDAGSKEVLHKIGAGRACAAVVALDAPGANYRCVWAL
SKFYPNVKTFVRAHDVVHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPTSEIANTI
NEFRTRHLSELTELCEASGSSLGYGYSRTSKPKPQPSDASGDNQIIEGGTVVI

MDFASSVQRQSMFHGGADFASYCLPNRMISAKLCPKGLGGTRFWDPMIDSKVRSAIRSKR
NVSYRSSLTLNADFNGRFYGHLLPAKPQNVPLGFRLLCQSSDSVGDLVGNDRNLEFAEGS
DDREVTFSKEEKDTREQDSAPSLEELRDLLNKATKELEVASLNSTMFEEKAQRISEVAIA
LKDEAASAWNDVNQTLNVVQEAVDEESVAKEAVQKATMALSLAEARLQVALESLEAEGYN
TSEESEVRDGVKDKEEALLSAKADIKECQENLASCEEQLRRLQVKKDELQKEVDRLNEAA
ERAQISALKAEEDVANIMVLAEQAVAFELEATQRVNDAEIALQRAEKTLFGSQTQETTQG
KVLDGKNTIVGEDEVLSEIVDVSHQAERDLVVVGVSSDVGTQSYESDNENGKPTADFAKE
AEGEAEKSKNVVLTKKQEVQKDLPRESSSHNGTKTSLKKSSRFFPASFFSSNGDGTATVF
ESLVESAKQQWPKLILGFTLLGAGVAIYSNGVGRNNQLPQQPNIVSTSAEDVSSSTKPLI
RQMQKLPKRIKKLLEMFPQQEVNEEEASLLDVLWLLLASVIFVPLFQKIPGGSPVLGYLA
AGILIGPYGLSIIRNVHGTKAIAEFGVVFLLFNIGLELSVERLSSMKKYVFGLGSAQVLV
TAAVIGLITHYVAGQAGPAAIVIGNGLALSSTAVVLQVLQERGESTSRHGRATFSVLLFQ
DLAVVVLLILIPLISPNSSKGGIGFQAIAEALGLAAIKAAVAITGIIAGGRLFYNALIFW
YTQLLRPIYKQIAENRNAEIFSANTLLVILGTSLLTARAGLSMALGAFLAGLLLAETEFS
LQVESDIAPYRGLLLGLFFMTVGMSIDPKLLLANFPLIMGTLGLLLVGKTILVVIIGKLF
GISIISAVRVGLLLAPGGEFAFVAFGEAVNQGIMTPQLSSLLFLVVGISMALTPWLAAGG
QLIASRFELQDVRSLLPVESETDDLQGHIIICGFGRIGQIIAQLLSERLIPFVALDVSSD
RVAIGRSLDLPVYFGDAGSREVLHKIGADRACAAAIALDTPGANYRCVWALSKYFPNVKT
FVRAHDVDHGLNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPTSEIATTINEFRSRHLS
ELAELCEASGSSLGYGFSRSTSKPKPPSPSETSDDNQIIEGTLAI

www.000webhost.com

Other information
Ka divergence:-0.0520325KaKs divergence:0.081571
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3582Length 2 (bp):3558Length divergence:-0.003
MFE 1 (kcal):-1147.15MFE 2 (kcal):-1156.43MFE divergence0.004