Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02000-AT4G00110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-D-glucuronate 4-epimerase 2
Function (paralog2):UDP-D-glucuronate 4-epimerase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.39407178983731
Log2 mRNA fold difference:-0.43638839611757
Log2 TE fold difference:0.041676009829397
Sequences
Protein sequence

MSHLDDIPSTPGKFKMMDKSPFFLHRTRWQSSVAKLAFWSLVFFGLLFIFFYRSPISNPD
SSRRSLRTYSWGGPAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLG
LDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDLSLLKKLFEVVPFTHVMHLAAQAGVR
YAMENPGSYVHSNIAGFVNLLEVCKSANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPA
SLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIF
EGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTD
LVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPSTDLQTGLKKFVRWYL
GYYKQGGKKVAAAA

MKQMSHLDDIPSTPGKFKPYFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPVSSNPADP
SRRSLRTYSWGGPAWEKRVRSSARLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGL
DNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRY
AMENPSSYVHSNIAGFVNLLEVCKSANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPAS
LYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIFE
GVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDL
VTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDLQTGLKKFARWYLG
YYNGGKKAAS

Other information
Ka divergence:-0.226719KaKs divergence:0.680451
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):1305Length 2 (bp):1293Length divergence:-0.005
MFE 1 (kcal):-461.7MFE 2 (kcal):-440.1MFE divergence-0.024