Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02050-AT4G00040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chalcone and stilbene synthase family protein
Function (paralog2):Chalcone and stilbene synthase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7658611210909
Log2 mRNA fold difference:1.1066631723538
Log2 TE fold difference:0.69555300858616
Sequences
Protein sequence

MSNSRMNGVEKLSSKSTRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFI
KEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMALEASLG
CIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLR
VAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADPRECE
APFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKAGDE
SMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMRD
ELKKKGDAAQEWGLGLAFGPGITFEGLLIRSLTSS

MLVSARVEKQKRVAYQGKATVLALGKALPSNVVSQENLVEEYLREIKCDNLSIKDKLQHL
CKSTTVKTRYTVMSRETLHKYPELATEGSPTIKQRLEIANDAVVQMAYEASLVCIKEWGR
AVEDITHLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAE
NNPGSRVLLTTSETTVLGFRPPNKARPYNLVGAALFGDGAAALIIGADPTESESPFMELH
CAMQQFLPQTQGVIDGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKAGSGALELNDL
FWAVHPGGPAILSGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKGT
EGEEWGLGLAFGPGITFEGFLMRNL

Other information
Ka divergence:0.31258KaKs divergence:-0.333931
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1188Length 2 (bp):1158Length divergence:-0.013
MFE 1 (kcal):-404.52MFE 2 (kcal):-412.71MFE divergence0.01