Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02300-AT1G02305
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cysteine proteinases superfamily protein
Function (paralog2):Cysteine proteinases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9906764179827
Log2 mRNA fold difference:1.5853280066155
Log2 TE fold difference:0.95753565611913
Sequences
Protein sequence

MADSCCIRLHLLASVFLLLFSSFNLQGIAAENLSKQKLTSLILQNEIVKEVNENPNAGWK
AAFNDRFANATVAEFKRLLGVIQTPKTAYLGVPIVRHDLSLKLPKEFDARTAWSHCTSIR
RILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSDRFCIKYNLNVSLSANDVI
ACCGLLCGFGCNGGFPMGAWLYFKYHGVVTQECDPYFDNTGCSHPGCEPTYPTPKCERKC
VSRNQLWGESKHYGVGAYRINPDPQDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKYITG
TKIGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYFKIRRGTNECGIEQSVVAGLPS
EKNVFKGITTSDDLLVSSV

MADNCIRLLHSASVFFCLGLLISSFNLLQGIAAENLSKQKLTSWILQNEIVKEVNENPNA
GWKASFNDRFANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISLKLPKEFDARTAWSQCT
SIGRILDQGHCGSCWAFGAVESLSDRFCIKYNMNVSLSVNDLLACCGFLCGQGCNGGYPI
AAWRYFKHHGVVTEECDPYFDNTGCSHPGCEPAYPTPKCARKCVSGNQLWRESKHYGVSA
YKVRSHPDDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKHITGTNIGGHAVKLIGWGTSD
DGEDYWLLANQWNRSWGDDGYFKIRRGTNECGIEHGVVAGLPSDRNVVKGITTSDDLLVS
SF

www.000webhost.com

Other information
Ka divergence:-0.384597KaKs divergence:0.738563
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1140Length 2 (bp):1089Length divergence:-0.023
MFE 1 (kcal):-331.5MFE 2 (kcal):-314.21MFE divergence-0.027