Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02300-AT4G01610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cysteine proteinases superfamily protein
Function (paralog2):Cysteine proteinases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7660721525545
Log2 mRNA fold difference:3.1447894737331
Log2 TE fold difference:-0.40578946022278
Sequences
Protein sequence

MADSCCIRLHLLASVFLLLFSSFNLQGIAAENLSKQKLTSLILQNEIVKEVNENPNAGWK
AAFNDRFANATVAEFKRLLGVIQTPKTAYLGVPIVRHDLSLKLPKEFDARTAWSHCTSIR
RILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSDRFCIKYNLNVSLSANDVI
ACCGLLCGFGCNGGFPMGAWLYFKYHGVVTQECDPYFDNTGCSHPGCEPTYPTPKCERKC
VSRNQLWGESKHYGVGAYRINPDPQDIMAEVYKNGPVEVAFTVYEDFAHYKSGVYKYITG
TKIGGHAVKLIGWGTSDDGEDYWLLANQWNRSWGDDGYFKIRRGTNECGIEQSVVAGLPS
EKNVFKGITTSDDLLVSSV

MAVYNTKLCLASVFLLLGLLLAFDLKGIEAESLTKQKLDSKILQDEIVKKVNENPNAGWK
AAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLKLPKAFDARTAWPQCTSIG
NILDQGHCGSCWAFGAVESLSDRFCIQFGMNISLSVNDLLACCGFRCGDGCDGGYPIAAW
QYFSYSGVVTEECDPYFDNTGCSHPGCEPAYPTPKCSRKCVSDNKLWSESKHYSVSTYTV
KSNPQDIMAEVYKNGPVEVSFTVYEDFAHYKSGVYKHITGSNIGGHAVKLIGWGTSSEGE
DYWLMANQWNRGWGDDGYFMIRRGTNECGIEDEPVAGLPSSKNVFRVDTGSNDLPVASV

Other information
Ka divergence:-0.219594KaKs divergence:0.216776
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1140Length 2 (bp):1080Length divergence:-0.027
MFE 1 (kcal):-331.5MFE 2 (kcal):-326.31MFE divergence-0.008