Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02360-AT4G01700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chitinase family protein
Function (paralog2):Chitinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.6475604728798
Log2 mRNA fold difference:2.7072474150505
Log2 TE fold difference:-1.1352076478631
Sequences
Protein sequence

MAQQHSFLLLCFFLSISYLLSSAQTEATSIERLVPRDLYNKIFIHKDNTACPANGFYTYE
SFVQATRRFPRFGSVGSPVTQRLEVAAFLAQISHETTGGWATAPDGPYAWGLCFKEEVSP
QSTYCDSSDTQWPCFPNKTYQGRGPIQLSWNYNYGPAGRALGFDGLRNPETVSNNSVIAF
QTALWFWMTPQSPKPSCHDVMIGKYRPTAADLAANRTGGFGLTTNIINGGLECGIPGDGR
VNDRIGFFQRYTGLFKVATGPNLDCENQRPYA

MEKQISLLLCLLLFIFSISSSLHETEARKHNKYKPAPIMSLVPRTLYDQIFIHKDNNACP
AKGFYPYEAFVEATRSFPKFGSVGNFWTRRREVAAFLAQISHETTGGWATAPDGPYAWGL
CFKEEVSPQSNYCDASNKDWPCVSGKSYKGRGPIQLSWNYNYGQAGRALGFDGLQNPELV
ANNSVLAFKTALWFWMTEQTPKPSCHNVMVNRYRPTKADRAANRTVGYGLVTNIINGGLE
CGIPGDGRVTDRVGYFQRYAQLFKVTTGPNLDCENQRPFS

www.000webhost.com

Other information
Ka divergence:0.0858489KaKs divergence:0.358577
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):819Length 2 (bp):843Length divergence:0.014
MFE 1 (kcal):-243.13MFE 2 (kcal):-251.36MFE divergence0.017