Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02370-AT4G01990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.6865831281545
Log2 mRNA fold difference:-0.48695341570714
Log2 TE fold difference:-0.1909552583489
Sequences
Protein sequence

MNFRNLIASGSRLGKRFCATVFAPASATGIVEASVSSPAAANVVEASVSSPAAENGVRTS
VAAPTVASRQRELYKKLSMLSVTGGTVAETLNQFIMEGITVRKDDLFRCAKTLRKFRRPQ
HAFEIFDWMEKRKMTFSVSDHAICLDLIGKTKGLEAAENYFNNLDPSAKNHQSTYGALMN
CYCVELEEEKAKAHFEIMDELNFVNNSLPFNNMMSMYMRLSQPEKVPVLVDAMKQRGISP
CGVTYSIWMQSCGSLNDLDGLEKIIDEMGKDSEAKTTWNTFSNLAAIYTKAGLYEKADSA
LKSMEEKMNPNNRDSHHFLMSLYAGISKGPEVYRVWESLKKARPEVNNLSYLVMLQAMSK
LGDLDGIKKIFTEWESKCWAYDMRLANIAINTYLKGNMYEEAEKILDGAMKKSKGPFSKA
RQLLMIHLLENDKADLAMKHLEAAVSDSAENKDEWGWSSELVSLFFLHFEKAKDVDGAED
FCKILSNWKPLDSETMTFLIKTYAAAEKTSPDMRERLSQQQIEVSEEIQDLLKTVCP

MMHSVSRLARRFCATLATATAEISGEAAASVPTKAKKHRSIYKKLSSLGTRGGGKMEETL
NQFVMEGVPVKKHDLIRYAKDLRKFRQPQRALEIFEWMERKEIAFTGSDHAIRLNLIAKS
KGLEAAETYFNSLDDSIKNQSTYGSLLNCYCVEKEEVKAKAHFENMVDLNHVSNSLPFNN
LMAMYMGLGQPEKVPALVVAMKEKSITPCDITYSMWIQSCGSLKDLDGVEKVLDEMKAEG
EGIFSWNTFANLAAIYIKVGLYGKAEEALKSLENNMNPDVRDCYHFLINLYTGIANASEV
YRVWDLLKKRYPNVNNSSYLTMLRALSKLDDIDGVKKVFAEWESTCWTYDMRMANVAISS
YLKQNMYEEAEAVFNGAMKKCKGQFSKARQLLMMHLLKNDQADLALKHFEAAVLDQDKNW
TWSSELISSFFLHFEEAKDVDGAEEFCKTLTKWSPLSSETYTLLMKTYLAAGKACPDMKK
RLEEQGILVDEEQECLLSKICP

Other information
Ka divergence:0.227726KaKs divergence:0.208619
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1614Length 2 (bp):1509Length divergence:-0.034
MFE 1 (kcal):-491.13MFE 2 (kcal):-445.15MFE divergence-0.049