Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02380-AT4G01960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.69467284805567
Log2 mRNA fold difference:0.3523447153455
Log2 TE fold difference:0.079214619993596
Sequences
Protein sequence

MDQMLSGEQDLEVDIEAGRSDVTQESTSDTVSGNGVWSERANFGVSEKIADDLSYPLIRD
ENRVETSSQSLDLSEKKCGNGKFKKSRKASKPPRPPKGPSLSENDRKIMRDIQELAMRKR
ARIERMKKSLKRLKAAKTSPSSPCITIFSMIITAIFFAFLVFQGFSTGSSSMNSDKSPAP
TVSPNNQMISVQFYNDFAPVEQTDPSPTTSLRYTRKRISGAEEEDSRDVTR

MDQIVSGEEEDLDVDIEDGRFNETQEITTNLVSAEGDSENVLNHVWSGRLSFDGSEKSAD
DLVDPLMGEGKRRERSSQSLDLSDMKFDNDKFKKTRKPSKPPRPPKGPLLSANDQKLMRE
ITELAMRKRARIERMKTLRRLKAAKSSSPCSSIFAMIVTVIFFVFLIFQGFFTSNASLNS
DNSPAPNNSANNRMVSVQFYNEFAPRERIDPSPTTSFRYKRVSGADNEENTREVTR

Other information
Ka divergence:-0.164114KaKs divergence:0.0107027
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):696Length 2 (bp):711Length divergence:0.011
MFE 1 (kcal):-178.57MFE 2 (kcal):-189.3MFE divergence0.029