Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02390-AT4G01950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycerol-3-phosphate acyltransferase 2
Function (paralog2):glycerol-3-phosphate acyltransferase 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.5554486722732
Log2 mRNA fold difference:4.8086666550469
Log2 TE fold difference:-0.40070548640241
Sequences
Protein sequence

MSGNKISTLQALVFFLYRFFILRRWCHRSPKQKYQKCPSHGLHQYQDLSNHTLIFNVEGA
LLKSNSLFPYFMVVAFEAGGVIRSLFLLVLYPFISLMSYEMGLKTMVMLSFFGVKKESFR
VGKSVLPKYFLEDVGLEMFQVLKRGGKRVAVSDLPQVMIDVFLRDYLEIEVVVGRDMKMV
GGYYLGIVEDKKNLEIAFDKVVQEERLGSGRRLIGITSFNSPSHRSLFSQFCQEIYFVRN
SDKKSWQTLPQDQYPKPLIFHDGRLAVKPTPLNTLVLFMWAPFAAVLAAARLVFGLNLPY
SLANPFLAFSGIHLTLTVNNHNDLISADRKRGCLFVCNHRTLLDPLYISYALRKKNMKAV
TYSLSRLSELLAPIKTVRLTRDRVKDGQAMEKLLSQGDLVVCPEGTTCREPYLLRFSPLF
SEVCDVIVPVAIDSHVTFFYGTTASGLKAFDPIFFLLNPFPSYTVKLLDPVSGSSSSTCR
GVPDNGKVNFEVANHVQHEIGNALGFECTNLTRRDKYLILAGNNGVVKKK

MSAKISIFQALVFLFYRFILRRYRNSKPKYQNGPSSLLQSDLSRHTLIFNVEGALLKSDS
LFPYFMLVAFEAGGVIRSFLLFILYPLISLMSHEMGVKVMVMVSFFGIKKEGFRAGRAVL
PKYFLEDVGLEMFEVLKRGGKKIGVSDDLPQVMIEGFLRDYLEIDVVVGREMKVVGGYYL
GIMEDKTKHDLVFDELVRKERLNTGRVIGITSFNTSLHRYLFSQFCQEIYFVKKSDKRSW
QTLPRSQYPKPLIFHDGRLAIKPTLMNTLVLFMWGPFAAAAAAARLFVSLCIPYSLSIPI
LAFSGCRLTVTNDYVSSQKQKPSQRKGCLFVCNHRTLLDPLYVAFALRKKNIKTVTYSLS
RVSEILAPIKTVRLTRDRVSDGQAMEKLLTEGDLVVCPEGTTCREPYLLRFSPLFTEVSD
VIVPVAVTVHVTFFYGTTASGLKALDPLFFLLDPYPTYTIQFLDPVSGATCQDPDGKLKF
EVANNVQSDIGKALDFECTSLTRKDKYLILAGNNGVVKKN

www.000webhost.com

Other information
Ka divergence:-0.0654499KaKs divergence:-0.525297
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1593Length 2 (bp):1563Length divergence:-0.01
MFE 1 (kcal):-474MFE 2 (kcal):-456MFE divergence-0.019