Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02460-AT4G01890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.11329012064079
Log2 mRNA fold difference:-0.31161031814638
Log2 TE fold difference:0.35938724476378
Sequences
Protein sequence

MLTSTYNRNQVLGFMTLILTLMSLSEARNHHHKEKHKHNNHNHHSSKPKPPSSSISQPPT
PPPGPPDSPAPSLPPSPSDDPADDNNGIYNVRKYGAVGDGETDDTEAFKTAWDSSCNNEN
NTDSVLLVPYGYTFMIQSTIFTGPCRSYQFFQVDGTIVTPDGPESWPSNISKRQWLVFYR
VNGMALKGEGVIDGRGQKWWDLPCKPHRSVNKSAIVTGPCDSPIALRFFMSSNLRVEGLQ
IKNSPQFHFRFDGCQGVHVESLHITAPPLSPNTDGIHIENSNSVTIYNSIISNGDDCVSI
GSGSYDVDIRNLTCGPGGHGISIGSLGNHNSRACVSNITVRDSVIKYSDNGVRIKTWQGG
SGSVSGVTFNNIHVDSVRNPIIIDQYYCMTKDCANKTSAVFVSDIAYQGIKGTYDIRSPP
MHFGCSDAVPCTNLTLSDIELLPAKGEIVLDPFCWNAYGIAEELSIPPVWCLMSDPPKGL
QGSLVDKCGSS

MLKLSRDPILCITTLILIITFSLLSYGTEARLHHQASQPPSPSPNPNDPSKSPSRSQDLD
HEVVYDVRKYGAVGNGVADDTVSFKTAWDSACSNNKNNTASVLHVPYGFTFMIRSTIFTG
PCRSYQYFQVDGTIVPRDGPKSWPSSLNKRQWLAFYRINGMALQGAGVIDGRGQNWWDLP
CKPHQQNVNKTKLAGPCESPAALRFFMSSNVIVKGLSIKNSPQVHLKLDGCHVVHINSLR
IISPPASPNTDGIHIENSNSVEIYNSVISNGDDCVSIGPGAYDIDIRNITCGPGGHGISI
GSLGEKNSHACVSNVTVRDSFIKFSENGVRIKTWQGGSGSVSGVTFDNIHVDTVRNPIII
DQYYCTTKSCANKTSAVFVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSNIELLP
SKEDIVVGPFCWNAYGITDEFSVPLISCLKSNPSTSLLSGLSGRCGSP

www.000webhost.com

Other information
Ka divergence:0.338161KaKs divergence:0.303785
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1476Length 2 (bp):1407Length divergence:-0.024
MFE 1 (kcal):-438.69MFE 2 (kcal):-393.9MFE divergence-0.054