Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02500-AT4G01850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosylmethionine synthetase 1
Function (paralog2):S-adenosylmethionine synthetase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.39295188181331
Log2 mRNA fold difference:-0.57152780577459
Log2 TE fold difference:0.13181602966293
Sequences
Protein sequence

METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK
ATVDYEKIVRDTCRAIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKCPEEIGA
GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDK
GAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMAR
RALVQVSYAIGVPEPLSVFVDTYETGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNG
RFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA

METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTK
ATIDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGA
GDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNGTCRWLRPDGKTQVTVEYYNDN
GAMVPVRVHTVLISTQHDETVTNDEIARDLKEHVIKPIIPEKYLDDKTIFHLNPSGRFVI
GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGMAR
RALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKETFDFRPGMMTINLDLKRGGNG
RFQKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA

Other information
Ka divergence:0.20087KaKs divergence:-0.00191205
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1182Length 2 (bp):1182Length divergence:0
MFE 1 (kcal):-379.1MFE 2 (kcal):-393.4MFE divergence0.019