Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02520-AT1G02530
Species:Arabidopsis
Duplication type:TD
Function (paralog1):P-glycoprotein 11
Function (paralog2):P-glycoprotein 12

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.55420058889
Log2 mRNA fold difference:-3.198238915497
Log2 TE fold difference:0.66381805364208
Sequences
Protein sequence

MNGDGAREGDSVSHEPSTSKSPKEGEETKKEEKSEEKANTVPFYKLFAFADSSDVLLMIC
GSIGAIGNGMSLPFMTLLFGDLIDSFGKNQNNKDIVDVVSKVCLKFVYLGLGTLGAAFLQ
VACWMITGERQAARIRSTYLKTILRQDIGFFDVETNTGEVVGRMSGDTVLIQDAMGEKVG
KFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIPLLAMAGAAMALIVTRASSRGQAAYAKAA
TVVEQTIGSIRTVASFTGEKQAINSYKKFITSAYKSSIQQGFSTGLGLGVMFFVFFSSYA
LAIWFGGKMILEKGYTGGAVINVIIIVVAGSMSLGQTSPCVTAFAAGQAAAYKMFETIKR
KPLIDAYDVNGKVLEDIRGDIELKDVHFSYPARPDEEIFDGFSLFIPSGATAALVGESGS
GKSTVISLIERFYDPKSGAVLIDGVNLKEFQLKWIRSKIGLVSQEPVLFSSSIMENIAYG
KENATVEEIKAATELANAAKFIDKLPQGLDTMVGEHGTQLSGGQKQRIAIARAILKDPRI
LLLDEATSALDAESERVVQEALDRVMVNRTTVIVAHRLSTVRNADMIAVIHRGKMVEKGS
HSELLKDSEGAYSQLIRLQEINKDVKTSELSSGSSFRNSNLKKSMEGTSSVGNSSRHHSL
NVLGLTTGLDLGSHSQRAGQDETGTASQEPLPKVSLTRIAALNKPEIPVLLLGTVAAAIN
GAIFPLFGILISRVIEAFFKPAHELKRDSRFWAIIFVALGVTSLIVSPTQMYLFAVAGGK
LIRRIRSMCFEKAVHMEVAWFDEPQNSSGTMGARLSADATLIRALVGDALSLAVQNVASA
ASGLIIAFTASWELALIILVMLPLIGINGFVQVKFMKGFSADAKSKYEEASQVANDAVGS
IRTVASFCAEEKVMQMYKKQCEGPIKDGIKQGFISGLGFGFSFFILFCVYATSFYAGARL
VEDGKTTFNNVFQVFFALTMAAIGISQSSTFAPDSSKAKVAAASIFAIIDRKSKIDSSDE
TGTVLENVKGDIELRHLSFTYPARPDIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLL
QRFYDPDSGHITLDGVELKKLQLKWLRQQMGLVGQEPVLFNDTIRANIAYGKGSEEAATE
SEIIAAAELANAHKFISSIQQGYDTVVGERGIQLSGGQKQRVAIARAIVKEPKILLLDEA
TSALDAESERVVQDALDRVMVNRTTIVVAHRLSTIKNADVIAVVKNGVIAEKGTHETLIK
IEGGVYASLVQLHMTASN

MNRDGAGEGDSVSHEHSTSKTDEKAKTVPLYKLFAFADSFDVFLMICGSLGAIGNGVCLP
LMTLLFGDLIDSFGKNQNNKDIVDVVSKVCLKFVYLGLGRLGAAFLQVACWMITGERQAA
KIRSNYLKTILRQDIGFFDVETNTGEVVGRMSGDTVHIQDAMGEKVGKFIQLVSTFVGGF
ALAFAKGWLLTLVMLTSIPFLAMAGAAMALLVTRASSRGQAAYAKAATVVEQTIGSIRTV
ASFTGEKQAINSYKKYITSAYKSSIQQGFSTGLGLGVMIYVFFSSYALAIWFGGKMILEK
GYTGGSVINVIIIVVAGSMSLGQTSPCVTAFAAGQAAAYKMFETIKRKPLIDAYDVNGKV
LGDIRGDIELKDVHFSYPARPDEEIFDGFSLFIPSGATAALVGESGSGKSTVINLIERFY
DPKAGEVLIDGINLKEFQLKWIRSKIGLVCQEPVLFSSSIMENIAYGKENATLQEIKVAT
ELANAAKFINNLPQGLDTKVGEHGTQLSGGQKQRIAIARAILKDPRVLLLDEATSALDTE
SERVVQEALDRVMVNRTTVVVAHRLSTVRNADMIAVIHSGKMVEKGSHSELLKDSVGAYS
QLIRCQEINKGHDAKPSDMASGSSFRNSNLNISREGSVISGGTSSFGNSSRHHSLNVLGL
FAGLDLGSGSQRVGQEETGTTSQEPLRKVSLTRIAALNKPEIPVLLLGTVVAAINGAIFP
LFGILISRVIEAFFKPADQLKKDSRFWAIIFVALGVTSLIVSPSQMYLFAVAGGKLIRRI
QSMCFEKAVHMEVSWFDEPENSSGTMGARLSTDAALIRALVGDALSLAVQNAASAASGLI
IAFTASWELALIILVMLPLIGINGFLQVKFMKGFSADAKSKYEEASQVANDAVGSIRTVA
SFCAEEKVMQMYNKQCEGPIKDGVKQGFISGLGFGFSFFILFCVYATSFYAAARLVEDGK
TTFIDVFQVFFALTMAAIGISQSSTFAPDSSKAKVAAASIFAIIDRKSKIDSSDETGTVL
ENVKGDIELRHLSFTYPARPGIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLLQRFYD
PDSGQITLDGVELKKLQLKWLRQQMGLVGQEPVLFNDTIRANIAYGKGSEEAATESEIIA
AAELANAHKFISSIQQGYDTVVGEKGIQLSGGQKQRVAIARAIVKEPKILLLDEATSALD
AESERLVQDALDRVIVNRTTVVVAHRLSTIKNADVIAIVKNGVIAENGTHETLIKIDGGV
YASLVQLHMTASN

www.000webhost.com

Other information
Ka divergence:0.562389KaKs divergence:0.575117
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3837Length 2 (bp):3822Length divergence:-0.002
MFE 1 (kcal):-1223.43MFE 2 (kcal):-1214.95MFE divergence-0.003