Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02520-AT4G01830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-glycoprotein 11
Function (paralog2):P-glycoprotein 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3932822108455
Log2 mRNA fold difference:-1.8633645878106
Log2 TE fold difference:0.78857148150991
Sequences
Protein sequence

MNGDGAREGDSVSHEPSTSKSPKEGEETKKEEKSEEKANTVPFYKLFAFADSSDVLLMIC
GSIGAIGNGMSLPFMTLLFGDLIDSFGKNQNNKDIVDVVSKVCLKFVYLGLGTLGAAFLQ
VACWMITGERQAARIRSTYLKTILRQDIGFFDVETNTGEVVGRMSGDTVLIQDAMGEKVG
KFIQLVSTFVGGFVLAFIKGWLLTLVMLTSIPLLAMAGAAMALIVTRASSRGQAAYAKAA
TVVEQTIGSIRTVASFTGEKQAINSYKKFITSAYKSSIQQGFSTGLGLGVMFFVFFSSYA
LAIWFGGKMILEKGYTGGAVINVIIIVVAGSMSLGQTSPCVTAFAAGQAAAYKMFETIKR
KPLIDAYDVNGKVLEDIRGDIELKDVHFSYPARPDEEIFDGFSLFIPSGATAALVGESGS
GKSTVISLIERFYDPKSGAVLIDGVNLKEFQLKWIRSKIGLVSQEPVLFSSSIMENIAYG
KENATVEEIKAATELANAAKFIDKLPQGLDTMVGEHGTQLSGGQKQRIAIARAILKDPRI
LLLDEATSALDAESERVVQEALDRVMVNRTTVIVAHRLSTVRNADMIAVIHRGKMVEKGS
HSELLKDSEGAYSQLIRLQEINKDVKTSELSSGSSFRNSNLKKSMEGTSSVGNSSRHHSL
NVLGLTTGLDLGSHSQRAGQDETGTASQEPLPKVSLTRIAALNKPEIPVLLLGTVAAAIN
GAIFPLFGILISRVIEAFFKPAHELKRDSRFWAIIFVALGVTSLIVSPTQMYLFAVAGGK
LIRRIRSMCFEKAVHMEVAWFDEPQNSSGTMGARLSADATLIRALVGDALSLAVQNVASA
ASGLIIAFTASWELALIILVMLPLIGINGFVQVKFMKGFSADAKSKYEEASQVANDAVGS
IRTVASFCAEEKVMQMYKKQCEGPIKDGIKQGFISGLGFGFSFFILFCVYATSFYAGARL
VEDGKTTFNNVFQVFFALTMAAIGISQSSTFAPDSSKAKVAAASIFAIIDRKSKIDSSDE
TGTVLENVKGDIELRHLSFTYPARPDIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLL
QRFYDPDSGHITLDGVELKKLQLKWLRQQMGLVGQEPVLFNDTIRANIAYGKGSEEAATE
SEIIAAAELANAHKFISSIQQGYDTVVGERGIQLSGGQKQRVAIARAIVKEPKILLLDEA
TSALDAESERVVQDALDRVMVNRTTIVVAHRLSTIKNADVIAVVKNGVIAEKGTHETLIK
IEGGVYASLVQLHMTASN

MKKGNLEANTKTVPFYKLFFFSDSTDVLLMIVGSIGAIANGVCSPLMTLLFGELIDAMGP
NQNNEEIVERVSKVCLSLVYLGLGALGAAFLQVACWMITGERQAARIRSLYLKTILRQDI
GFFDVEMTTGEVVGRMSGDTVLILDAMGEKVGKFIQLISTFVGGFVIAFLRGWLLTLVML
TSIPLLAMSGAAIAIIVTRASSQEQAAYAKASNVVEQTLGSIRTVASFTGEKQAMSSYKE
LINLAYKSNVKQGFVTGLGLGVMFLVFFSTYALGTWFGGEMILRKGYTGGAVINVMVTVV
SSSIALGQASPCLTAFTAGKAAAYKMFETIEREPLIDTFDLNGKVLEDIRGEIELRDVCF
SYPARPKEEVFGGFSLLIPSGTTTALVGESGSGKSTVISLIERFYDPNSGQVLIDGVDLK
EFQLKWIRGKIGLVSQEPVLFSSSIMENIGYGKEGATVEEIQAASKLANAAKFIDKLPLG
LETLVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERVVQEALDRIMVN
RTTVIVAHRLSTVRNADIIAVIHRGKIVEEGSHSELLKDHEGAYSQLLRLQEINKESKRL
EISDGSISSGSSRGNNSTRQDDDSFSVLGLLAGQDSTKMSQELSQKVSFTRIAALNKPEI
PILILGTLVGAVNGTIFPIFGILFAKVIEAFFKAPHELKRDSRFWSMIFVLLGVAAVIVY
PTTNYLFAIAGGRLIRRIRSMCFEKVVHMEVGWFDEPGNSSGAMGARLSADAALIRTLVG
DSLCLSVKNVASLVTGLIIAFTASWEVAIIILVIIPFIGINGYIQIKFMKGFSADAKAKY
EEASQVANDAVGSIRTVASFCAEEKVMEMYKKRCEDTIKSGIKQGLISGVGFGISFFVLY
SVYASCFYVGARLVKAGRTNFNDVFQVFLALTLTAVGISQASSFAPDSSKGKGAAVSIFR
IIDRISKIDSRDESGMVLENVKGDIELCHISFTYQTRPDVQVFRDLCLSIRAGQTVALVG
ESGSGKSTVISLLQRFYDPDSGHITLDGVELKKLRLKWLRQQMGLVGQEPVLFNDTIRAN
IAYGKGGEEATEAEIIAASELANAHRFISSIQKGYDTVVGERGIQLSGGQKQRVAIARAI
VKEPKILLLDEATSALDAESERVVQDALDRVMVNRTTIVVAHRLSTIKNADVIAVVKNGV
IAEKGTHETLINIEGGVYASLVQLHINASN

Other information
Ka divergence:0.312475KaKs divergence:0.0554061
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3837Length 2 (bp):3693Length divergence:-0.019
MFE 1 (kcal):-1223.43MFE 2 (kcal):-1189.94MFE divergence-0.014