Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02610-AT4G02075
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/FYVE/PHD zinc finger superfamily protein
Function (paralog2):RING/FYVE/PHD zinc finger superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.13315189225349
Log2 mRNA fold difference:-0.21383069001092
Log2 TE fold difference:-0.029178059044313
Sequences
Protein sequence

MGDVVLFIDETYLKSSFNRCRICHEEEAESYFEAPCSCSGTIKFAHRDCIQRWCDEKGNT
ICEICLQEYKPGYTTTSKPSRFIETAVTIRDNLHIMRRENGRRRRNRRLVNREESDFQEC
NSGVDRGASCCRYLALIFSVILLIKHAFDAVYGTEEYPYTIFTVLTLKAIGILLPMLVII
RTITAIQRSLRYQILESEEDTLSSEEEDHGLEEEEQQQHIA

MGDVILFIDDTKSKVRITRCRICHEEEEESFFEVPCACSGTVKFAHRNCIQRWCNEKGNT
TCEICLQVYKDGYTAVLKQSKLIEQEVTIRVNGRRRRRSRRLVSIAESDISQCNSVADRG
ASFCRSLTFTLSVFLLMKHTFDVIYGTEEYPFSVFTVLTLKAIGILLPMFIIIRTISTIQ
KTLRRRHQYPESEEEDRLSSDDDDDLEEEDEEQQQHLA

www.000webhost.com

Other information
Ka divergence:-0.0722883KaKs divergence:-0.999812
GC content 1 (%):37GC content 2 (%):36GC content divergence:-0.014
Length 1 (bp):666Length 2 (bp):657Length divergence:-0.007
MFE 1 (kcal):-160.57MFE 2 (kcal):-169.52MFE divergence0.027