Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02620-AT4G02080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ras-related small GTP-binding family protein
Function (paralog2):secretion-associated RAS super family 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.9346004881701
Log2 mRNA fold difference:5.5982752752365
Log2 TE fold difference:-1.7732575504688
Sequences
Protein sequence

MGPLTRVLILVEWFSQVDALVYLVDAYDQERFAESKKELDALLSDESLATVPFLILGNKI
DIPYAASEDELRFHLGLSNFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQY
IK

MFMIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELS
IGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDESLA
SVPFLILGNKIDIPYAASEDELRYHLGLSNFTTGKGKVNLTDSNVRPLEVFMCSIVRKMG
YGEGFKWVSQYIK

Other information
Ka divergence:-0.898646KaKs divergence:0.999812
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):369Length 2 (bp):582Length divergence:0.224
MFE 1 (kcal):-108.8MFE 2 (kcal):-169.4MFE divergence0.218