Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02650-AT4G02100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Heat shock protein DnaJ with tetratricopeptide repeat

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.41186232488055
Log2 mRNA fold difference:-0.36859525571852
Log2 TE fold difference:0.75544032358354
Sequences
Protein sequence

MAIHPWWKRNRKKVDKYMKNAKDLITSQDPNDIVSALSLLNSTLSISPHHELALELKARS
LLYLRRFKDVAVLLHNYIPSLRIDNEDVSSVFAASSELSSLMLLLPSGSPSHDSSFKCFS
YSYLKKKVMAGLSNNSQVQGQWRYLVLGQACYHLGLMDDAIILLQTGKRLATAELRRESI
CWSEDSFNLSTSESQPQPITESEIVSQMLSQTKLFLRRRTAALAALDAGLYSESIRHFSK
IIDSRRGAPQSFLVYCLIRRAFAYKSAGRIADSIADCNLILALEPSCIEALETRAELFRS
IRCFPDSLHDLEHLKLLFNSILRDRSLTGPVWKRHNVRYREIPGKLCVLTTNIKQMKEKI
TNRENGNEDYYSLMGIERGCSRSELNRAYLLLNLRYKSERSMTSIDRFDIIDEQELVSVK
NRARMSTLLLYRLIQKGYYAVLSDIETVEADKAVAIDNRRIETPMDGNKAVAMTVVRKSN
DKLDVVVKGVFCRDMAAVGSLISRAGLRQPITV

MAVYGEKKHWWLRNKKIVDKYMKEAKSLIASQDPNDVKSALNLLESALSVSPRYELALEL
KARSLLYLRRYKDVADMLQDYIPSLKLAGGGEDSGIGSSELSFTHSSRESVKLLNDLPSH
HHHHDSSFKCFSVSDLKKKVMAGLTKNCDEQGQWRYLVLGQACCHLGLMEDAMVLLQTGK
RLATAAFRRQSICWSDDSFILFSSEDGGSSPPSSVVVTSASQPRSESIAHVLSHIKLLLR
RRAAALAALDAGLYTESIRHFSKILDSRRGAPQGFLAQCFMHRASAYRSAGRIAESIADC
NKTLALDPSCLQALETRAALLESVRCFPDSLHDLEHLKLLYNSILRDRKLPGPVWKRHNV
RYREIPGKLCVLTTKIQQLKQKIANGEIGNVDYYALMGIRRDCSRSELDRAYLLLNLKHK
PERSMSFIDRFELTDDEEELDSVKDRARMSTLLLYRLIQKGYSVVTSNIAAVEKQRKAIA
AAVATESHRSNIIETPIRAVAVAVNSNNNTNVVKGVFCRDLTVVGSLIARTGFNQPIPVK
YEALSC

www.000webhost.com

Other information
Ka divergence:-0.407175KaKs divergence:-0.860509
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1542Length 2 (bp):1641Length divergence:0.031
MFE 1 (kcal):-471.72MFE 2 (kcal):-503.4MFE divergence0.032