Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02690-AT4G02150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):importin alpha isoform 6
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6094927062054
Log2 mRNA fold difference:1.799634735997
Log2 TE fold difference:-0.094591567404591
Sequences
Protein sequence

MSYKPSAKTEVRRNRYKVSVDADEGRRRREDNMVEIRKNKREENLQKKRREGFNPSMASQ
PGQDFSSSLPTETRLENIQQMIAGVMSEDRDLQLEATASFRRLLSIERNPPINEVVQSGV
VPHIVQFLSRDDFTQLQFEAAWALTNIASGTSENTRVIIDSGAVPLFVKLLSSASEEVRE
QAVWALGNVAGDSPKCRDHVLSCEAMMSLLAQFHEHSKLSMLRNATWTLSNFCRGKPQPA
FEQQTKAALPALERLLHSTDEEVLTDASWALSYLSDGTNEKIQTVIDAGVIPRLVQLLAH
PSPSVLIPALRTIGNIVTGDDIQTQAVISSQALPGLLNLLKNTYKKSIKKEACWTISNIT
AGNTSQIQEVFQAGIIRPLINLLEIGEFEIKKEAVWAISNATSGGNHDQIKFLVSQGCIR
PLCDLLPCPDPRVVTVTLEGLENILKVGEAEKNLGNTGNDNLYAQMIEDADGLDKIENLQ
SHDNNEIYEKAVKILESYWAADDEEEDIGGVDAPENVQSSGFQFGNQSGNAPTGGFNFG

MSLRPSAKTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGSAT
GQTEQDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSGVV
PRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQ
AVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAF
EQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSS
PSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAG
NADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVSQGCIKPL
CDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQSH
DNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNFI

Other information
Ka divergence:-0.0155148KaKs divergence:-0.110483
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1620Length 2 (bp):1596Length divergence:-0.007
MFE 1 (kcal):-530.3MFE 2 (kcal):-462.64MFE divergence-0.068