Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02720-AT4G02130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):galacturonosyltransferase 5
Function (paralog2):galacturonosyltransferase 6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.0585691675568
Log2 mRNA fold difference:2.8103052281288
Log2 TE fold difference:-0.47132123973616
Sequences
Protein sequence

MHWITRFSAFFSAALAMILLSPSLQSFSPAAAIRSSHPYADEFKPQQNSDYSSFRESPMF
RNAEQCRSSGEDSGVCNPNLVHVAITLDIDYLRGSIAAVNSILQHSMCPQSVFFHFLVSS
ESQNLESLIRSTFPKLTNLKIYYFAPETVQSLISSSVRQALEQPLNYARNYLADLLEPCV
KRVIYLDSDLVVVDDIVKLWKTGLGQRTIGAPEYCHANFTKYFTGGFWSDKRFNGTFKGR
NPCYFNTGVMVIDLKKWRQFRFTKRIEKWMEIQKIERIYELGSLPPFLLVFAGHVAPISH
RWNQHGLGGDNVRGSCRDLHSGPVSLLHWSGSGKPWLRLDSKLPCPLDTLWAPYDLYKHS
H

MLWITRFAGLFSAAMAVIVLSPSLQSFPPAAAIRSSPSPIFRKAPAVFNNGDECLSSGGV
CNPSLVHVAITLDVEYLRGSIAAVNSILQHSVCPESVFFHFIAVSEETNLLESLVRSVFP
RLKFNIYDFAPETVRGLISSSVRQALEQPLNYARSYLADLLEPCVNRVIYLDSDLVVVDD
IAKLWKTSLGSRIIGAPEYCHANFTKYFTGGFWSEERFSGTFRGRKPCYFNTGVMVIDLK
KWRRGGYTKRIEKWMEIQRRERIYELGSLPPFLLVFSGHVAPISHRWNQHGLGGDNVRGS
CRDLHPGPVSLLHWSGSGKPWIRLDSKRPCPLDALWTPYDLYRHSH

Other information
Ka divergence:-0.0704155KaKs divergence:-0.697082
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):1086Length 2 (bp):1041Length divergence:-0.021
MFE 1 (kcal):-307.09MFE 2 (kcal):-345.6MFE divergence0.059