Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02800-AT4G02290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cellulase 2
Function (paralog2):glycosyl hydrolase 9B13

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.8921339938578
Log2 mRNA fold difference:2.8261904489566
Log2 TE fold difference:0.079106625159939
Sequences
Protein sequence

MALYLSSSRLITFLSFILLLSNGFSSSSSRPSIHHRHHLDNHNYKDALSKSILFFEGQRS
GKLPPNQRMTWRSNSGLSDGSALNVDLVGGYYDAGDNMKFGFPMAFTTTMLSWSLIEFGG
LMKSELPNAKDAIRWATDFLLKATSHPDTIYVQVGDPNMDHACWERPEDMDTPRSVFKVD
KNNPGSDIAGEIAAALAAASIVFRKCDPSYSNHLLQRAITVFTFADKYRGPYSAGLAPEV
CPFYCSYSGYQDELLWGAAWLQKATNNPTYLNYIKANGQILGADEFDNMFSWDNKHVGAR
ILLSKEFLIQKVKSLEEYKEHADSFICSVLPGASSSQYTPGGLLFKMGESNMQYVTSTSF
LLLTYAKYLTSARTVAYCGGSVVTPARLRSIAKKQVDYLLGGNPLKMSYMVGYGLKYPRR
IHHRGSSLPSVAVHPTRIQCHDGFSLFTSQSPNPNDLVGAVVGGPDQNDQFPDERSDYGR
SEPATYINAPLVGALAYLARS

MALLLVSSSSSYALRVTIFLSFFFFLCNGFSYPTTSSLFNTHHHRHHLAKHNYKDALTKS
ILFFEGQRSGKLPSNQRMSWRRDSGLSDGSALHVDLVGGYYDAGDNIKFGFPMAFTTTML
SWSVIEFGGLMKSELQNAKIAIRWATDYLLKATSQPDTIYVQVGDANKDHSCWERPEDMD
TVRSVFKVDKNIPGSDVAAETAAALAAAAIVFRKSDPSYSKVLLKRAISVFAFADKYRGT
YSAGLKPDVCPFYCSYSGYQDELLWGAAWLQKATKNIKYLNYIKINGQILGAAEYDNTFG
WDNKHAGARILLTKAFLVQNVKTLHEYKGHADNFICSVIPGAPFSSTQYTPGGLLFKMAD
ANMQYVTSTSFLLLTYAKYLTSAKTVVHCGGSVYTPGRLRSIAKRQVDYLLGDNPLRMSY
MVGYGPKFPRRIHHRGSSLPCVASHPAKIQCHQGFAIMNSQSPNPNFLVGAVVGGPDQHD
RFPDERSDYEQSEPATYINSPLVGALAYFAHAYGQL

www.000webhost.com

Other information
Ka divergence:-0.207459KaKs divergence:-0.189474
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):1506Length 2 (bp):1551Length divergence:0.015
MFE 1 (kcal):-453.64MFE 2 (kcal):-417.58MFE divergence-0.041