Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02810-AT4G02330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant invertase/pectin methylesterase inhibitor superfamily
Function (paralog2):Plant invertase/pectin methylesterase inhibitor superfamily

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.53132587339115
Log2 mRNA fold difference:-0.24111550898727
Log2 TE fold difference:-0.28542538494465
Sequences
Protein sequence

MESPIFILITLSFFLQSVLASSQTLSNSSTICKTTPDPKYCKSVFPHSQGNVQQYGCFSI
RKSLSQSRKFIRTVDRYIKRNAHLSQPAVIRALQDCRFLAGLTMDYLLTSFETVNDTSAK
TSFKPLSFPKADDIQTLLSAALTNEQTCLEGLTTAASYSATWTVRTGVALPLVNDTKLLG
VSLALFTKGWVPKKKKRAGFAWAQPRSGSSTHTKPFRLFRNGALPLKMTEKTKAVYESLS
RRKLADGDSNGDGDDGSMVLISDIVTVSQDGTGNFTNITAAVAAAPNNTDGSAGFFLIYV
TAGIYEEYISIAKNKRYMMMIGDGINQTVVTGNRSVVDGWTTFNSATFAVTAPNFVAVNI
TFRNTAGPEKHQAVALRSGADFSIFYSCSFEAYQDTLYTHSLRQFYRECDVYGTVDFIFG
NAAVVFQNCNLYPRKPMPNQFNAITAQGRSDPNQNTGTSIQNCTIKPADDLVSSNYTVKT
YLGRPWKEYSRTVYMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTNRVTW
PGYHVINSTDAANFTVTGLFIEADWIWKTGVPYTSGLIS

MLSLKLFLVTLFLSLQTLFIASQTLLPSNSSSTICKTTPDPKFCKSVFPQTSQGDVREYG
RFSLRKSLTQSRKFTRTIDRYLKRNNALLSQSAVGALQDCRYLASLTTDYLITSFETVNI
TTSSKTLSFSKADEIQTLLSAALTNEQTCLDGINTAASSSWTIRNGVALPLINDTKLFSV
SLALFTKGWVPKKKKQVASYSWAHPKNTHSHTKPFRHFRNGALPLKMTEHTRAVYESLSR
RKLADDDNDVNTVLVSDIVTVNQNGTGNFTTITEAVNSAPNKTDGTAGYFVIYVTSGVYE
ENVVIAKNKRYLMMIGDGINRTVVTGNRNVVDGWTTFNSATFAVTSPNFVAVNMTFRNTA
GPEKHQAVAMRSSADLSIFYSCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGNAAVVF
QDCNLYPRQPMQNQFNAITAQGRTDPNQNTGISIHNCTIKPADDLVSSNYTVKTYLGRPW
KEYSRTVFMQSYIDEVVEPVGWREWNGDFALSTLYYAEYNNTGSGSSTTDRVVWPGYHVI
NSTDANNFTVENFLLGDGWMVQSGVPYISGLLS

Other information
Ka divergence:0.0278808KaKs divergence:-0.0684089
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1740Length 2 (bp):1722Length divergence:-0.005
MFE 1 (kcal):-523.95MFE 2 (kcal):-481.41MFE divergence-0.042