Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02820-AT4G02380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Late embryogenesis abundant 3 (LEA3) family protein
Function (paralog2):senescence-associated gene 21

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:6.2498998987412
Log2 mRNA fold difference:7.4019537429297
Log2 TE fold difference:-1.5420272017761
Sequences
Protein sequence

MARSLANAKIQSVFGSEKLSNAVFRRGFAAAAKTALDGSVSTAEMKKRAGEASSEKAPWV
PDPKTGYYRPETVSEEIDPAELRAILLNNKQ

MARSISNVKIVSAFVSRELSNAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVEEST
QKISWVPDPKTGYYRPETGSNEIDAAELRAALLNNKQ

Other information
Ka divergence:-0.261053KaKs divergence:-0.0806019
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):276Length 2 (bp):294Length divergence:0.032
MFE 1 (kcal):-90.1MFE 2 (kcal):-105.97MFE divergence0.081