Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02840-AT4G02430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.3115879149285
Log2 mRNA fold difference:-2.5286915061459
Log2 TE fold difference:0.21907834069238
Sequences
Protein sequence

MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAED
AIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGSFNGGGRGGGRGRGDGGSRGPSRRSEFR
VLVTGLPSSASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTE
FRNAFSNGYVRVREYDSRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSPKAKS
SRRSPAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKPSPAKSPIHTRS
PSR

MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADD
AIYGRDGYDFDGHHLRVELAHGGRRSSHDARGSYSGRGRGGRGGGDGGGRERGPSRRSEY
RVVVSGLPSSASWQDLKDHMRKGGEVCFSQVFRDGRGTTGIVDYTSYEDMKYALDDTEFR
NAFSHEYVRVREYDSRRDSRSPSRGRSYSKSRSRGRSPSRSRSRSRSRSKSRSPKAKSLR
RSPAKSTSRSPRSRSRSKSRSLSPRGWVTVERHWIALI

Other information
Ka divergence:-0.0292962KaKs divergence:-0.119936
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):912Length 2 (bp):837Length divergence:-0.043
MFE 1 (kcal):-311MFE 2 (kcal):-279.14MFE divergence-0.054