Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02890-AT4G02480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AAA-type ATPase family protein
Function (paralog2):AAA-type ATPase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0223541553062
Log2 mRNA fold difference:0.98638355524985
Log2 TE fold difference:0.036012692237884
Sequences
Protein sequence

MVDTRRSSSASKRFCAATSSSSRPTKRSKAAAEPASSSSASEVPIDNQAPVSDPGSISGD
PELRTSDPQSNDAERPVTTTDVPAMETDTNPELEGLVTPTPAGEVVVEAEKSKSSKKRIA
KAPWAKLLSQFPQNPHLVMRGSVFTVGRRACDLCIRDHSMPNVLCELRQSEHGGPSVASL
EIIGNGVLVQVNGKIYQRSTCVHLRGGDEIIFTTPGKHAYIFQPLKDENLAAPDRTSSLS
LFEAQSAPLKGLHVETRARDSSSVDGTASLLASISKLQNVPFLPPTAKSVKRQQNSEVPV
LPSSCDDFILDVDLNDADSNNDHAAIASMEKTVASTSCAANDDHDADGNGMDPFQEPEAG
NIPDPAYEIRPILSLLGDPSEFDLRGSISKILVDERREVREMPKEYERPSASVLTRRQAH
KDSLRGGILNPQDIEVSFENFPYFLSGTTKDVLMISTYAHIKYGKEYAEYASDLPTACPR
ILLSGPSGSEIYQEMLAKALAKQCGAKLMIVDSLLLPGGSTPKEADTTKESSRRERLSVL
AKRAVQAAQAAVLQHKKPISSVEAGITGGSTLSSQAVRRQEVSTATSKSYTFKAGDRVRF
LGPSTSSLASLRAPPRGPATGFQGKVLLAFEGNGSSKIGVRFDRSIPDGNDLGGLCEEDH
GFFCTASSLRLESSSSDDADKLAINEIFEVAFNESERGSLILFLKDIEKSVSGNTDVYIT
LKSKLENLPENIVVIASQTQLDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDTFGGRLQD
RNTEMPKAVKQITRLFPNKVTIQLPEDEASLVDWKDKLERDTEILKAQANITSIRAVLSK
NQLVCPDIEILCIKDQTLPSDSVEKVVGFAFNHHLMNCSEPTVKDNKLIISAESITYGLQ
LLHEIQNENKSTKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFSDIGALENVKDTLKELV
MLPLQRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF
GEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTK
DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDSANRSKILSVILAKEEMAEDVDLEA
IANMTDGYSGSDLKNLCVTAAHLPIREILEKEKKERSVAQAENRAMPQLYSSTDVRPLNM
NDFKTAHDQVCASVASDSSNMNELQQWNELYGEGGSRKKTSLSYFM

MVETRRSSSASKRFCASSSSPEASSSQRPNKRSKVKIDAAASSLEPATAEPAGSSSASEV
PIENQGPASDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEVEVLATP
TVAGEAVADADKSKAAKKRALKAPWAKLLSQYSQNPHRVIRGPVFTVGRRGCDLSIRDQA
MPSTLCELKQSEHGGPSVASLEILGNGVIVHVNGKCYQKSTCVHLRGGDEVIFSLNGKHA
YIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDVDGASDVDGASILASLSKL
RSFHLLPPIAKAGKRQQNPAVPVVPSSFNDCISDTDMNDADSNNDHAAVASVEKIAAAST
PGTANENLNVDGSGLDPFQEADGGNVPAAGYEIRPIVHLLGESSSFDIRGSISRLLDERR
EVKEFLREFDLSSTISTRRQAFKDSLRGGVLNAQNIDISFENFPYYLSATTKGVLMISMY
VHMNGGSKYANFATDLTTACPRILLSGPSGSEIYQEMLAKALAKQFGAKLMIVDSLLLPG
GSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQHKKPTSSVDADITGGSTLSSQALPKQ
EVSTATSKSYTFKAGDRVKFVGPSASAISSLQGQLRGPAIGSQGKVALAFEDNCASKIGI
RFDRPVQDGNDLGGLCEEDHGFFCAASSLRLEGSSSDDADKLAVNEIFEVALSESEGGSL
ILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVIASQTQLDSRKEKSHPGGFLFTKFGG
NQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQEEALLSDWKEKLDRD
TEILKVQANITSILAVLAKNKLDCPDLGTLCIKDQTLPSESVEKVVGWAFGHHLMICTEP
IVKDNKLVISAESISYGLQTLHDIQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGV
SFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVAT
EAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHE
AMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSK
ILSVILAKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHFPIREILEKEKKEKTAAQA
ENRPTPPLYSCTDVRSLTMNDFKAAHDQVCASVSSDSSNMNELQQWNELYGEGGSRKKTS
LSYFM

Other information
Ka divergence:0.0357369KaKs divergence:0.00780097
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):3741Length 2 (bp):3798Length divergence:0.008
MFE 1 (kcal):-1172.9MFE 2 (kcal):-1190.44MFE divergence0.007