Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G02920-AT1G02930
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutathione S-transferase 7
Function (paralog2):glutathione S-transferase 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.55048787847457
Log2 mRNA fold difference:1.1732234314242
Log2 TE fold difference:-0.64936911581776
Sequences
Protein sequence

MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFED
GDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQV
LKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGT
PTKKLFDERPHVSAWVADITSRPSAKKVL

MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFED
GDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVL
KPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTP
TKKLFDERPHVSAWVADITSRPSAQKVL

www.000webhost.com

Other information
Ka divergence:-0.411124KaKs divergence:0.999586
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):630Length 2 (bp):627Length divergence:-0.002
MFE 1 (kcal):-178.7MFE 2 (kcal):-178.4MFE divergence-0.001