Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03040-AT4G02590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.034540057552001
Log2 mRNA fold difference:-0.20338453426824
Log2 TE fold difference:0.17584964652199
Sequences
Protein sequence

MANNNNIPHDSISDPSPTDDFFEQILGLSNFSGSSGSGLSGIGGVGPPPMMLQLGSGNEG
NHNHMGAIGGGGPVGFHNQMFPLGLSLDQGKGHGFLKPDETGKRFQDDVLDNRCSSMKPI
FHGQPMSQPAPPMPHQQSTIRPRVRARRGQATDPHSIAERLRRERIAERIRSLQELVPTV
NKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTEMPLSSSVEDETQAVWEK
WSNDGTERQVAKLMEENVGAAMQLLQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNP
PP

MASNNPHDNLSDQTPSDDFFEQILGLPNFSASSAAGLSGVDGGLGGGAPPMMLQLGSGEE
GSHMGGLGGSGPTGFHNQMFPLGLSLDQGKGPGFLRPEGGHGSGKRFSDDVVDNRCSSMK
PVFHGQPMQQPPPSAPHQPTSIRPRVRARRGQATDPHSIAERLRRERIAERIRALQELVP
TVNKTDRAAMIDEIVDYVKFLRLQVKVLSMSRLGGAGAVAPLVTDMPLSSSVEDETGEGG
RTPQPAWEKWSNDGTERQVAKLMEENVGAAMQLLQSKALCMMPISLAMAIYHSQPPDTSS
VVKPENNPPQ

www.000webhost.com

Other information
Ka divergence:-0.390175KaKs divergence:-0.139032
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):909Length 2 (bp):933Length divergence:0.013
MFE 1 (kcal):-289.6MFE 2 (kcal):-309.72MFE divergence0.034