Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03060-AT4G02660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Beige/BEACH domain ;WD domain, G-beta repeat protein
Function (paralog2):Beige/BEACH domain ;WD domain, G-beta repeat protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.21602184936397
Log2 mRNA fold difference:1.1946818888599
Log2 TE fold difference:-1.4157523750719
Sequences
Protein sequence

MKWATLLKDIKEKVGLAQSSDSDPFPVDLTAPPSSSSSSSSPSFTYPSSSSLHHFNFSPS
SRDNHELELDFKRLWEEFRSSSSEKEKEAALNLTVDIFCRLVKRHANVDQLVTMLVETHI
FSFVIGRAFVTDIEKLKIGSKTRSLNVEKVLRFFSDVTKEGFSPGANLLTAVEVLVSGPI
DKQSLLDSGIFCCLIHVLIALLAYDELSKSKITGDLEVVSAEKDAGYIVLQTRRLEVEGS
VVHIMKALASNPSAAQSLIEDDSLESLFNMVANGSITVFSQYKEGLVPLHNIQLHRHAMQ
ILGLLLVNDNGSTARYIRKHHLIKVLLMAVKEFDPSCGDSAYTMGIVDLLLECVELSYRP
EAGGVRLREDIRNAHGYHFLVQFALVLSSLPKNPIFVSSNHDSGSDDPEVFHDGENTNST
ENADFSSQNFAPSLSRLLDVLVTLAQTGPAEPSVGRASRSSQTKPTGHSRSRTSSVDSIY
DETWEQGSGKVKDLEAVQMLQDIFLKAENKDLQAEVLNRMFKIFSSHVENYRLCQELRTV
PLLVLNMAGFPSSLQDIILKILEYAVTVVNCVPEQELLSLCCLLQQPITSQLKHTILSFF
VKLISFDQQYKKVLREVGVLEVLQDDLKQHKLLIGPDQYSGVSSHSDRKPSSGSFRKNLD
TKDAIISSPKLMESGSGKLPVFEVDNTITVGWDCLISLLKKAEANQSSFRAANGVAIILP
FLISDAHRSGVLRILSCLITEDTKQVHHDELGAVVDLLKSGMVTGISGHQYKLHDDAKCD
TMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGKREHMDESDLTVYIKLFKYLFRL
MTAAVCENAVNRMKLHAVITSQTFFELLAESGLLCVELERQVIQLLLELALEVVVPPFLT
SESTALATIPENENTTFVVTTPSGQFNPDKERIYNAGAVRVLIRSLLLFSPKMQLEFLRL
LESLARASPFNQENLTSIGCVELLLEIIYPFLAGSSPFLSYALKIVEILGAYRLSPSELR
MLFRYVLQMRIMNSGHAIVGMMEKLILMEDTALEHLSLAPFVELDMSKTGHASVQVSLGE
RSWPPAAGYSFVCWFQFRNFLTTQGKESEASKAGGSSKTRMTSAQQHEQNIFRMFSVGAV
SNESPFYAELYFQEDGILTLATSNSHSLSFSGLEIEEGRWHHLAVVHSKPNALAGLFQAS
VAYVYLDGKLRHTGKLGYSPSPVGKSLQVTVGTPATCARVSDLTWKTRSCYLFEEVLTSG
CIGFMYILGRGYKGLFQDADLLRFVPNQACGGGSMAILDSLDTDMTSSSNGQKFDGSNRQ
GDSKADGSGIVWDLERLGNLAFQLPGKKLIFAFDGTCSEFIRASGNFSLLNLVDPLSAAA
SPIGGIPRFGRLVGNVSICRQSVIGDTIRPVGGMTVVLALVEAAESRNMLHMALSLLACA
LHQNPQNVKDMQTIRGYHLLALFLRPKMTLFDMQSLEIFFQIAACEALFSEPKKLESVQS
NITMPPTETIFENSYEDLSLSRFRYDSSSVGSHGDMDDFSVPKDSFSHLSELETDIPVET
SNCIVLSNADMVEHVLLDWTLWVTSPVSIQIALLGFLENLVSMHWYRNHNLTILRRINLV
EHLLVTLQRGDVEVPVLEKLVVLLGCILEDGFLTSELENVVRFVIMTFNPPEVKSRSSLL
RESMGKHVIVRNMLLEMLIDLQVTIKAEDLLELWHKIVSSKLITYFLDEAVHPTSMRWIM
TLLGVCLASSPNFSLKFRTSGGYQGLLRVLQNFYDSPDIYYILFCLIFGKPVYPRLPEVR
MLDFHALVPNDGSYVELKFIELLDSVVAMAKSTYDRLIMQSMLAHQSGNLSQVSASLVAE
LIEGAEMTGELQGEALMHKTYAARLMGGEASAPAAATSVLRFMVDLAKMCPQFSTACRRA
EFVENCADLYFSCVRAAYAVKMAKQLSVKAEEKHINDADDSGSQGSLPHDQDQSTKTSIS
VGSFPQGQVSLGSEDMSLPANYVVNDKMENILPPPTQDTSKSLQGVEDVKKQDDHHVGPS
ASSERDFQDFTGNPVQVQATDSQSSASFPMIESPLLSEKSSLKVSFTPSPSPVVALASWL
GSNYNESKSSTLGSPSLESYVSVNEVDASSERKSGSQGSSAANAFFTVSPKLLLETDETG
YGGGPCSAGASAVLDFMAEALADLVTEQIKAVPVLESILEMVPFYVDPESVLVFQGLCLS
RVMNYLERRLLRDDEEDEKKLDKAKWSVNLDAFCWMIVDRVYMGAFSQPAGVLRALEFLL
SMLQLANKDGRVEEVTPSGKGLLSLGRATRQLDAYVHSILKNTNRMVLYCFLPSFLITIG
EEDLLSQLGLLVESKKRPSPNPATDESGIDISTVLQLLVANRRIIFCPSNLDTDLNCCLC
VNLISLLLDQRKSVQNMSLDIVKYLLVHRRSALEDLLVTKPNQGQNFDVLHGGFDKLLTG
NLPEFFKWLESSDKIINKVLEQCAAIMWVQYIAGSAKFPGVRIKGMEGRRKREMGRKSRD
MSKLDLKHWDQLNERRYALEVLRDAMSTELRVVRQNKYGWILHAESEWQTHLQQLVHERG
IFPMRKSKGTEDPEWQLCPIEGPYRMRKKLERCKLKIDSIQNVLDGKLELGEIELPKVKN
EDGPVISDTDSEPPFLLSELYDESFLKESDDFKDVASARNGWNDDRASSTNEASLHSALD
FGGKSSIASVPITDTTHVKSETGSPRHSSSAKMDETNGREEKSEKELNDDGEYLIRPYLE
HLEKIRFRYNCERVVDLDKHDGIFLIGEFCLYVIENFYIDEDGCICEKECEDELSVIDQA
LGVKKDVSGSSDFHSKSSTSWTTTVKTGAVGGRAWAYGGGAWGKEKMCMTGNLPHPWRMW
KLNNVHEILKRDYQLRPVAIEIFSMDGCNDLLVFHKKEREEVFKNLVAMNLPRNSMLDTT
ISGSAKQESNEGGRLFKLMAKSFSKRWQNGEISNFQYLMHLNTLAGRGYSDLTQYPVFPW
VLADYDSESLDFSDPKTFRKLHKPMGCQTPEGEEEFRKRYESWDDPEVPKFHYGSHYSSA
GIVLFYLIRLPPFSSENQKLQGGQFDHADRLFNSIKDTWLSAAGKGNTSDVKELIPEFFY
MPEFLENRFSLDLGEKQSGEKVGDVFLPPWARGSVREFILKHREALESDYVSENLHHWID
LIFGYKQRGKAAEEAVNVFYHYTYEGNVDIDAVTDPAMKASILAQINHFGQTPKQLFPKA
HVKRRTDRKIPLHPLKHSMHLVPHEIRKCSSSISQIITFHDKVLVAGANCFLKPRGYTKY
ITWGFPDRSLRFMSYDQDKLLSTHENLHESNQIQCAGVSHDGRIVVTGAEDGLVCVWRVS
KDGPRGSRRLRLEKALCAHTAKVTCLRVSQPYMMIASGSDDCTVIIWDLSSLSFVRQLPD
FPVPISAIYINDLTGEIVTAAGTVLAVWSINGDCLAVANTSQLPSDSVLSVTGSTSSDWL
ETSWYVTGHQSGAVKVWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKF
HKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRASMKQASLKQASLKQASLKQASS
V

MKWGTLLKDLKDKVGVAETTADLIAGEAISDPTTPPSSSQASPSSSFAALAQHDFNLLSP
TSRDKLKLELDFKRYWEEFRSSSSEQEKEAALNLSVNTFCRLVKQHANVDQLVTMLVEPH
IFSFVIGRAFVADVEKLKVSSRKRSLDVEKAIEFFSEVTKDGSSHGANLLTAIEVLASGP
FDKQSLLDSGILCCLIHTFNAFLTYSVASEGEKTVNYEEKVEGSVVNIMKALASHPSAAQ
SLIEDDSLQLLFKMVANGSLMAFSRFKVGLVSFHNIQLHKNAMQILGLLLVNDNGSTASY
IRKHHLIKVLLMAVKDFDPDCGDSAYTVGIVDLLLECVELSYRPETGGVRLKDDIRNAHG
YHFLVQFALILSSMPKDIVFAFDHSSPHKNRGSNDSKKQPPLSLKTRQNDDSEKQQSLSL
NSRQNDEFALKHFSPALSRLLDVLVTLAQTGPIESSGTSTSLLSQTKLTGYSRRQTPSAN
NRYDEPCEQGSGKVKDLEAVQMLQDIFLKAENKDLQAEVLNRMFKIFTSHLENYRICQEL
KTVPLLVLNMGGFPSSLQELILKILEYAVTVVNCVPEQELLSLCFLLQQPIDSELKHTIL
SFFVKLTSFDQQYKKVLGEVGVLEVLQDDLKQHKLLRGPDQYSGVSNHLDRVPSSPSFKQ
HLDSQDAIISSPKLMESGSGKLPIFEVERTITVGWDCMISLLKNSQVNQEAFRSANGVTV
ILPFLIADEHRTSILRIFSCLITGDIKQVHHEELEALIDVLKSGMVTRVSGDQYKLHYEV
RCDIMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGEEECRDESHLMVYIKLFKHL
LRLITTAVCENAINRMKLHSVITSQTFYDLLVESGLLCVDLERHVIQLLLELALEVLVPP
FLTSESMASAEMAECEKASFLVKTASGQFNPDKQKIYNAGAVRVLIRSLLLCTPKLQLEF
LNLLERLARASPFNKETLTSAGCVELLLEIIYPFLQGSSPFLSHALKIVEVLGAYRLSPS
ELKMLCRYVMQMRVMNSGPSLIGMMEKLILMEEDTGLECVSLAPFVEMDMSKTGHASVQV
SLGERSWPPAAGYSFVCWVQFRNFLTTQELESEVYKAGGSSKTPILSGQQSEQNIFRIFS
VNAISNGSPSYAELYFQEDGILTLATSNSNSLSFSGLETEEGKWHHLAVVHSKPNALAGL
FQASVAYVYIDGKLRHMGKLGYSPSPVGKSLQVIIGTSATCARACGGDSMAILDLLDTDM
SSGIQKFEDSNRQGDSKAHCSGIVWDLDRLGNLSIQLPGKKLIFAFDGTCSEFMRATGSF
SLVNLVDPLSAAASLIGGIPRFGRLVGNVSLCRQNVIGNSIRPVGGMAVVLALVEAAESR
DMLHMALSLLACALHQNSQNVKDMETYTGYHLLALFLRPKMALFDMQCLEIFFQISACEA
FFSEPKKLESGQTTISMSPTEIIPENNYEDPTLCKFQYETSSVGSHGDMDDFSGRKDSFS
HLSELEMGDNPVETSNCIVLSNADMVEHVLLDWTLWVTAPVSIQIASLGFLENLISILWY
RSHNLAILRQINLVKHLLVTLQRGDVEVLVLEKLVILLRCILENGFLTPELEDVVRFAIM
TFNPPEIKSQNSSMRESMGKHVIVRNLVLEMLIDLQVTIKAEELLEQWHKTVSSKLITYF
LDGAVHPSSMRWIMTLLGVCLTSSPNFSLKFFASGGYQGLVRVLQSFYDSPDIYYILFCL
IFGKPVYPRLPEVRMLDFHALMPDDGSHVELNFVDLLDSVVAMAKSTFDRLIMQSMLAHQ
SGNLSQVSARCVAELVEGYADMTGELQGKALMHKTYAARLMGGEASAPATATSVIRFMVD
LAKMCPQFSAACKNTEFLQKCADLYFSCVRAFHAVKLAKQLSMKAEEQNITGGDDSSVEG
NFCRVSHQDMSTKTSISAGSFPQDQTSSVISVDMYIPSDYVAVDKVENFLTTPPGESNKS
FQGREYIAKQDGDHVGSVSASSEMKSLDLTGSSSQVQPIDSRSSESFSMLESPLLSEKSS
LEVPFIPSPSKSSTISTPHPSHISVSEFDASSDQSSGSQGSSAVHTLFTISPKVLLETDE
SGYGGGPCSAGASAVLDFMAEVCADIMTEQIKAVQALESILEMLPLYVDPECVVVFQGLC
LSRVMNYLERRFLRDDEEDDKKLDKRKWSANLDAFCWMIVDRVYMGAFPQPTGVLRTLEF
LLSILQLANKDGRVEEVTSSGKGLLSIGRATRQLDAYVHSILKNTNRTILYCFLPSFLIT
IGEEDLPSRLGLLVESTKKQTSKLSGKESGIDVSAVLQLLVANKNIILCPSNLDTDLNCC
LCVNLISLLHDQRKNVQNMASNIIKYLLVHRKSALEDLLVKKPHRGQKFDVLHGGFDRLL
TGNLPEFSKWLESSEQIITKVLEQGAAVMWIQYIAGSAKFPDVRMKGMDGRRTREMGRKL
RDTSKLDLKHWEQVNERRYALEVVRDAMSAELRVVRQNKYGLILHAESVWPTHLQQLVHE
RGIFPMRISHGVEDLKWQLCPIEGPYRMRKKLERCKLKIDSLHNLLEGKLELGEIELLKS
KSEDGLVISDMDSEPAFLLSELYSESFSEEADDLKDVPSARNGWNNDRATSTNAASLHNS
LSFGGKSSSTAVSVPISVNTDEKSETGSPIKSSSGKMDEIKHVEEESEKELKDDGEYLIR
PYLEHLEKIRFRYNCERVVGLDKHDGIFLIGELCLYVIENFYIDDHGCICEKECEDELSI
IDQAQGLKKQFHGSLESKSKSSTLWSTTIKIGAVGGRAWAYGGGAWGKEKVRVTGNLPHP
WHMWKLDSVHEILKRDYELRRVAVEIFSMDGCNDLLVFHKKEREEVFRNLLAMNLPRNSM
LDTTISGSAKQESKEGSRLFKLMAKSFTKRWQNGEISNFQYLMHLNTLAGRGYSDLTQYP
VFPWILADYDGESLDLSDPNNFRKLDKPMGCQTPEGEEEFRKRYESWDDPEVPQFHYGSH
YSSAGIVLFYLIRLPPFSAENQKLQGGQFDHADRLFNSIRETWLSAAGKGNTSDVKELIP
EFFYMPEFLENRFNLDLGEKQSGDKVGDVILPPWARGSVREFIRKHREALESDYVSENLH
HWIDLIFGHKQRGKAAENAVNVFYHYTYEGNVDVDAVTDPAMKASILAQINHFGQTPKQL
FQKPHVKRRTDRKVPPHPLKHSMHLVPRNIRKCSSSINQIITFNDKLLLTGANCLLKPRG
YKKYIRWGFPDRTLRFMSYDQDKLLSTHENLHEGNQIQCAGVSHDGRIVVTGAEDGLVSV
WRVSKDGPRGSRRLRLEKSLCAHTAKVICLRVSQPYMMIASSSDDCTVIIWDLSSLSFVR
QLPNFSVPVTVVYINDLTGEIVTAAGSVLAVWSINGDCLSVVNTSQLPTDLIVSVAGSTF
SDWLETTWYVTGHQSGALKVWRMVHCTDPVSVPSKTPSNRTGGLNLGNQKPEYKLLLHKE
LKFHKQPVTSLHLTTDLKQLLSGDSAGHLLSWTVPDEILKASLKKAS

www.000webhost.com

Other information
Ka divergence:0.357019KaKs divergence:0.368573
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):10806Length 2 (bp):10584Length divergence:-0.01
MFE 1 (kcal):-3295.5MFE 2 (kcal):-3198.41MFE divergence-0.015