Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03080-AT4G02710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):kinase interacting (KIP1-like) family protein
Function (paralog2):Kinase interacting (KIP1-like) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.2041228991966
Log2 mRNA fold difference:-0.27776429781763
Log2 TE fold difference:-0.75269290672433
Sequences
Protein sequence

MTAVVNGNSKRYSWWWDSHISPKNSKWLQENLTDMDSKVKQMIKVIEEDADSFARRAEMY
YKKRPELMKLVEEFYRAYRALAERYDHATGVIRHAQQTMAEAFPNQDPMMFGEESPLGSS
TDGFDPQTPDSYPPIRAPVYPDDLRKGAFGISSSHLSTVKRNIAFMEDPQSVSSGKGFKT
AKARKGLNFNNVDGKEINAKVLSESERASKAEAEIVALKDALSKVQAEKEASLAQFDQNL
EKLSNLESEVSRAQEDSRVLIERATRAEAEVETLRESLSKVEVEKESSLLQYQQCLQNIA
DLEDRISLAQKEAGEVDERANRAEAETLALKQSLVSSETDKEAALVQYQQCLKTISNLEE
RLHKAEEDSRLTNQRAENAEGEVESLKQKVSKLIEENEAYELQYQQCLDTIADLKLKLFH
AQEETQRLSREIEDGVAKLKFAEEKCVVLERSNQNLHSELDGLLEKLGNQSHELTEKQKE
LGRLWTCVQEENLRFMEAETAFQTLQQLHSQSQEELSTLALELQNRSQILKDMEARNNGL
QEEVQEAKDQSKSLNELNLSSAASIKSLQEEVSKLRETIQKLEAEVELRVDQRNALQQEI
YCLKEELSQIGKKHQSMVEQVELVGLHPESFGSSVKELQEENSKLKEIRERESIEKTALI
EKLEMMEKLVQKNLLLENSISDLNAELETIRGKLKTLEEASMSLAEEKSGLHSEKDMLIS
RLQSATENSKKLSEENMVLENSLFNANVELEELKSKLKSLEESCHLLNDDKTTLTSERES
LLSHIDTMRKRIEDLEKEHAELKVKVLELATERESSLQKIEELGVSLNAKDCEYASFVQF
SESRMNGMESTIHHLQDENQCRVREYQVELDRAHDAHIEIIVLQKCLQDWLEKSSSLIAE
NQDIKEASKLLEKLVSELEEENIGKQVQIDSSINCIKILRTGIYQVLMKLEIIPGIGSGD
ENSRDQRNMHDILNRLEDMQTMLLSIRDENQHSAIENLVLIEFLRQLKSEAVGIETEKKI
LEEELESQCQQLSFSRDETQKLIFVNGELTTKVNQGVNREKVLMVEIEDFHRQVLQLRDD
YTILQGDNNKTLDEKAYLTKSTLQLEEEKCKLEDDISLLLSETIYQSNLIILLEDVILEK
LSGAMKLNEDLDRLSIVKCKLEEEVRELGDKLKSADIANFQLQVVLEKSNAELLSARSAN
VHLEHEIANVKVQKEKELLEAMLMISIMQNEKSELSKAVEGLECRYKEAKAIEEDRDKQV
LRLRGDYDEQVKKNSHSNEANLKLEADLMNLLMELEEIKVEKENLNQELFTERNEIELWE
SQSATLFGELQISAVHETLLEGLTNELVEACKNLESRSTLKDREIEQLKGRVNNLEDANK
GQNDLMCKYAQAIFLLKESIQSLEKHAMLHEFENGPATETASLVDNSDGFLEIQELHLRI
KAIEEAITKKLAMEELKTSSARRSRRRNGSLRKQNHEIYSEETEMITKDIVLDQVSDCSS
YGISTRDILKIEDDHSLEAKSQNPPKGKSLSEESLVVDKLEISDRFTDPNKDANKRKVLE
RLNSDLQKLSNLHVAVEDLKIKVETEEKDEKGKENEYETIKGQINEAEEALEKLLSINRK
LVTKVQNGFERSDGSKSSMDLDENESSRRRRISEQARRGSEKIGRLQLEIQRLQFLLLKL
EGDREDRAKAKISDSKTRILLRDYIYSGVRGERRKRIKKRFAFCGCVQPPPSP

MEIAAKSNSKRMYSWWWDSHNTPKNSKWLQDNLADMDSNVKQMIKVLEEDADSFARRAEM
YYRKRPELMKLVEEFYRAYRALAERYNHATGVIHKAHETIAEAFPNQVPLIFGDESHGGA
LTNDVDPQTPDMPPPFRARGNPDEFQQDALGFSLSHVHDVKRNIDFSEEPLFVSNGKARK
GLNFNDHGDGKGRNGLKDHILSESERASKAEAEVVALKDSLSKMQAEKQASLALFEKNLE
RLSNLESEVSRAQADSRGINDRAASAEAEIQTLRETLYKLESEKESSFLQYHKCLQKIAD
LEDGLSVAHKEAGERASKAETETLALKRSLAKAETDKETALIQYRQCLNTISNLEERLRK
AEEDARLINERAEKAGVEVENLKQTVSKLIKDKEASELQFQQCLNIIASLKVKLHHAQEE
TQSLSHEIEDGVAKLKFSEEKCLLLERSNQNLHSELDSLLEKLGNQSQKLTEKQTELVKL
WSCVQAEHLHFQEAETAFQTLQQLHSQSQEELNNLAVELQTVSQIMKDMEMRNNELHEEL
EQAKVENKGLNDLNFTMEKLVQKNLMLEKSISYLNSELESFRRKLKTFEEACQSLSEEKS
CLISENQHNVIENTVLIEWLRQLRLEAVGIATEKTDLEGKAKTIGDKLTDAETENLQLKR
NLLSIRSEKHHLEDEITNVKDQLHEKEKEFEEIKMEKEKLIQEVFKERKQVELWESQAAT
FFCDKQISVVHETLIEATTRELAEACKNLESKSASRDADIEKLKRSQTIVLLNESIKSLE
DYVFTHRESAGEVSKGADLMDEFLKLEGMCLRIKAIAEAIMEKEKFLMLENTNTYSMLEA
SLKQIKELKTGGGRSMRKQDGGSGRMRKQSHETEMVMKDIVLDQTSDGSSYEIVSKKGNS
ELDHLGFVELKPVKTHKTETKALSEESLIVEKVEIFDGFMDPNREVNKRRVLERLDSDLQ
KLENLQITVEDLKSKVETVEKEKTKVGENEYKTIKGQLEEGEEAIEKLFTVNRKLTTKAE
SEKDIDRRRRIFEHARRGTEKIGRLQSEIQRIQFLLMKLEGEREHRLRSKISDTKVLLRD
YIYGRTRSVSMKKRTKKRSVFCGCVQQPESP

Other information
Ka divergence:0.180087KaKs divergence:0.0406281
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):5202Length 2 (bp):3336Length divergence:-0.219
MFE 1 (kcal):-1497.82MFE 2 (kcal):-958.23MFE divergence-0.22