Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03130-AT4G02770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem I subunit D-2
Function (paralog2):photosystem I subunit D-1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.661889527495
Log2 mRNA fold difference:0.54433343608394
Log2 TE fold difference:0.99078987528837
Sequences
Protein sequence

MATQAAGIFSPAITTTTSAVKKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAP
VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP
NLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGL
NMRSIGKNVSPIEVKFTGKQSYDL

MATQAAGIFNSAITTAATSGVKKLHFFSTTHRPKSLSFTKTAIRAEKTDSSAAAAAAPAT
KEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIM
REGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGRE
GVGLNMRSIGKNVSPIEVKFTGKQSYDL

www.000webhost.com

Other information
Ka divergence:0.576898KaKs divergence:-0.188592
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):615Length 2 (bp):627Length divergence:0.01
MFE 1 (kcal):-157.79MFE 2 (kcal):-178.3MFE divergence0.061