Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03210-AT4G02860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phenazine biosynthesis PhzC/PhzF protein
Function (paralog2):Phenazine biosynthesis PhzC/PhzF protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.78266646853749
Log2 mRNA fold difference:0.22785795027888
Log2 TE fold difference:0.26427913746623
Sequences
Protein sequence

MAEKKRVKYFIVDAFAESAFKGNPAAVCFLEDDNERDDAWLQSLATEFNISETCFLTPII
GDLPRFRLRWFTPVAEVDLCGHATLASAHVLFSTGLVGSETVEFDTLSGILTAKHLKNDD
DGEESSIELDFPVVPTYEVNYIDDDLSLFSKALNGATILDVKATKKDLLVVLSSWEAVID
LKPRLDEISKCPCEGMMVTAAASDGSTYDFCSRYFAPRFGINEDPVTGSAHCALAHYWSL
RMNKCDFFAYQASSRGGTLKVHLDKEKQRVLLRGKAVTVMEGYVLV

MCDGKKEKNITLLKKIDRDMGKKKGVKYFVVDAFTDSAFKGNPAAVCFLNDDNERDDTWL
QSLAAEFNISETCFLIPITGFQARFSLRWFTPLAEVDLCGHATLASAHCLFSNGLVDSDM
VEFVTRSGILTAKRVSDTSELSDGEVKGGTFLIELNFPVVTTCDVNLSDVSSSMITKALN
GATIVDIKATATNNILVVLPSKESVTELQPRMDDILKCPCDGIIVTAAGSTGSSYDFYSR
YFAPKFGVDEDPVCGSAHCALAHYWSIKMNKFDFLAYQASSRSGTIRIHLDKEKQRVLLR
GKAVTVMEGHVLV

Other information
Ka divergence:0.00213531KaKs divergence:0.0515013
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):861Length 2 (bp):942Length divergence:0.045
MFE 1 (kcal):-261.54MFE 2 (kcal):-275.23MFE divergence0.026