Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03220-AT1G03230
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Eukaryotic aspartyl protease family protein
Function (paralog2):Eukaryotic aspartyl protease family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5345267629047
Log2 mRNA fold difference:-1.3018496801231
Log2 TE fold difference:-0.19106654359787
Sequences
Protein sequence

MAPSPIIFSVLLLFIFSLSSSAQTPFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVV
FDLGGRELWVDCDKGYVSSTYQSPRCNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGGIPD
NTVTGTATSGEFALDVVSIQSTNGSNPGRVVKIPNLIFDCGATFLLKGLAKGTVGMAGMG
RHNIGLPSQFAAAFSFHRKFAVCLTSGKGVAFFGNGPYVFLPGIQISSLQTTPLLINPVS
TASAFSQGEKSSEYFIGVTAIQIVEKTVPINPTLLKINASTGIGGTKISSVNPYTVLESS
IYNAFTSEFVKQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWR
IFGANSMVSVSDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNKFGFSSTLLGR
QTNCANFNFTSTA

MASSRIIIFSVLLLSIFSLSSSAQPSFRPKALLLPVTKDPSTLQYTTVINQRTPLVPASV
VFDLGGREFWVDCDQGYVSTTYRSPRCNSAVCSRAGSIACGTCFSPPRPGCSNNTCGAFP
DNSITGWATSGEFALDVVSIQSTNGSNPGRFVKIPNLIFSCGSTSLLKGLAKGAVGMAGM
GRHNIGLPLQFAAAFSFNRKFAVCLTSGRGVAFFGNGPYVFLPGIQISRLQKTPLLINPG
TTVFEFSKGEKSPEYFIGVTAIKIVEKTLPIDPTLLKINASTGIGGTKISSVNPYTVLES
SIYKAFTSEFIRQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLHSKDVVW
RIFGANSMVSVSDDVICLGFVDGGVNPGASVVIGGFQLEDNLIEFDLASNKFGFSSTLLG
RQTNCANFNFTSTA

www.000webhost.com

Other information
Ka divergence:0.253629KaKs divergence:-0.999695
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1302Length 2 (bp):1305Length divergence:0.001
MFE 1 (kcal):-420.44MFE 2 (kcal):-423.67MFE divergence0.004