Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03290-AT4G02880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.26080770651989
Log2 mRNA fold difference:0.10500990350721
Log2 TE fold difference:-0.33130906934878
Sequences
Protein sequence

MGFGSVYRSLTEIFPQIDARILRAVAIEHPKDADEAAAVVLSEIIPSFSSNLFHNFTQSS
YKSSGSISEREVEHGLEDVASRCRPFLGASGSKASTSSSSSSSETLPLVVTRDHNTRALS
TDLVSNMNELTTLQPNVDPDVCHKDLESEEIQSVKKARGKENGNYDLFGRCFDVTSNAKI
GLDVPEDDIASVVSLFSLDNVKLASNFWEDLGFDITWNQAENAVSKLVDSTPGDTMTTTQ
QGSCFEVGHGSTNLVDETSNRSLFSENGDTEIGDAFSTSTHVCSVDQLEDIIEDAKSNKK
NLLTEMETVTNIMREVELKEKDAEKSKEEAARGGLDTLQKVEELKKMLEHAKEANDMHAG
EVYGEKSILATEVKELENRLLNLSEERNKSLAILDEMRGSLEIRLAAALELKKTAEKEKK
DKEDSALKALAEQEANMEKVVQESKLLQQEAEENSKLRDFLMDRGQIVDTLQGEISVICQ
DVKLLKEKFENRVPLTKSISSSFTSSCGSSMKSLVLENPSERLNGVTETSNNNKFPEAAA
FFMNKEKDDCRDLLEDGWDIFDKETEQVVWY

MGYKAVYRSLTELFPQIDARLLKAVAIEHPKDVNEAAAVVVSEIVPFFYPNLADSSTQPE
NKTPGNVPTEVENAVERDMPFSVLSGSEMGGSYSGSASMAFEYHETRAPVTESVSKRNQL
THVMPNVVVDIQRKGKIGLSGSDESGVVSSEPPVSCQAGAKSTGDDWQGVEFHSTGNQAE
ASTSADSEDAVHKLVYPADNLAITQNSHPLQIRFGSIDVVNETSSGSLAVENSDAELSGS
NLVDEISKGSLADENGDPELDGAVSSVGNRSTQGCNMVHLEQIIEDAKSNKRTLFTVMES
IMNLMREVELQEKEAEKAKEDASIGGFDTLDKVEELKKMLEHAKEANDMAAGEVYGERSI
LTTEVNELENRLISLSEERDNSLSVLDEMRVDLEIRLATALGIKNAAEQEKQEKEGSARK
AFAEQEAIMERVVQESKLLQQEAEENSKLREFLMDHGRIVDSLQGEISVICQDIRHLKEK
FDNRVPLSQSISSSQTSCKLASSASSMKSLLTEKPLEASYETPEASSNNKSPKASVNERK
ELLDDGWDFFDKETEL

www.000webhost.com

Other information
Ka divergence:-0.0356562KaKs divergence:0.248337
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1716Length 2 (bp):1671Length divergence:-0.013
MFE 1 (kcal):-487.99MFE 2 (kcal):-523.83MFE divergence0.035