Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03340-AT4G02920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.8823056435795
Log2 mRNA fold difference:5.0867056137503
Log2 TE fold difference:0.78333984981449
Sequences
Protein sequence

MASHSYSTLRFSLLQELRSNEIIKTSRAYLVNPGGRKYEILPESSFNLKSQLLEPLKPFS
SFSKSNHFLEFDSTMMKHRLMDVHETGPDPVCLSLGITQQYARKEEVLEFLLSRSEEELK
EEGFDLSLLSELMGLDALRSSSQQPYAKPLLDLMVDANILFSSSRAELNDLVSTAAEFHR
LRNSTRWRKLSRLVPQFQRFDSEVPIDTLQLPEDAVTLAPPKSPKKTRLKPSPKKQNPKI
RDKEYDLYERNRLHACESLLSLMIGNEQHRKTTMLSLKKSRGELFELLTQCSIGFAGTGM
AVLFFLVCNVASRQVPFCANQFFEGAMSLSLVLLSWSVSRLREALVNFNRKTINEEEVSN
KVERRIKEVYFRAATVIAMVALRFG

MIKLCFMTSHGYSIPGLGLPQDLCNTEIIKQNSRSHLVNPGARQEIIPASSFNLNTELLE
PWKPVSSFSQFVEIDSAMMKPLLMDVHETAPESLILSFGIADKFARQEKVMEFLLSQSEE
FKEKGFDMSLLNELMEFESMKSSSQLRPYDTSSVLYLNQELGKPVLDLVRDMMENPEFSV
RSNGHVLFSSSSNPELNDLLSIASEFNLSRNSTTKWRQLSPLIPHFQRFESDVFTPAKLK
AVTVLAPLKSPEKSRLKSPRKHNTKRKAKERDLYKRNHLHAYESLLSLMIGNDHRHKHTT
VLSLQKSCGELSELLTQFSITAAGTGIAVLFSVVCSLASRRVPFCANKFFDTGLGLSLVI
LSWAVNRLREVIVHVNRKANKPCSSLKDDEIINSVERSMKEVYYRAATVIAVFALRFAC

Other information
Ka divergence:-0.298758KaKs divergence:0.363508
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1158Length 2 (bp):1260Length divergence:0.042
MFE 1 (kcal):-325.6MFE 2 (kcal):-364.7MFE divergence0.057