Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03440-AT4G03010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):RNI-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.703906666905
Log2 mRNA fold difference:-1.8827533743951
Log2 TE fold difference:0.16310108493603
Sequences
Protein sequence

MMMRFTKLVWCLMFLLRFGFFTEAILDPVDFLALQAIRKSLDDLPGSKFFESWDFTSDPC
GFAGVYCNGDKVISLNLGDPRAGSPGLSGRIDPAIGKLSALTELSIVPGRIMGALPATIS
QLKDLRFLAISRNFISGEIPASLGEVRGLRTLDLSYNQLTGTISPSIGSLPELSNLILCH
NHLTGSIPPFLSQTLTRIDLKRNSLTGSISPASLPPSLQYLSLAWNQLTGSVYHVLLRLN
QLNYLDLSLNRFTGTIPARVFAFPITNLQLQRNFFFGLIQPANQVTISTVDLSYNRFSGG
ISPLLSSVENLYLNSNRFTGEVPASFVERLLSANIQTLYLQHNFLTGIQISPAAEIPVSS
SLCLQYNCMVPPLQTPCPLKAGPQKTRPTTQCTEWRG

MRFATLFSVLLLLLRFGLIVESIIVPVDFLALQAIRKSLDDLPGSNFFDSWDFTSDPCNF
AGVYCDDDKVTALNLGDPRAGSPGLSGRIDPAIGKLSALTELSIVPGRIMGSLPHTISQS
KNLRFLAISRNFISGEIPASLSELRGLKTLDLSYNQLTGSIPPSIGSLPELSNLILCHNH
LNGSIPQFLSQSLTRIDLKRNNLTGIISLTSLPPSLQYLSLAWNQLTGPVYRVLLRLNQL
NYLDLSLNRFTGAIPGQIFTFPITNLQLQRNFFYGVIQPPNQVTIPTVDLSYNRFSGELS
PLLSNVQNLYLNNNRFTGQVPVSFVDRLLASNIQTLYLQHNFLTGIQISPAADIPVSSSL
CLQYNCMVLPVQTPCPVKAGLQKTRPTTQCSEWRG

Other information
Ka divergence:-0.0847667KaKs divergence:-0.104158
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):1194Length 2 (bp):1188Length divergence:-0.003
MFE 1 (kcal):-362.05MFE 2 (kcal):-368.46MFE divergence0.009