Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03445-AT4G03080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Serine/threonine protein phosphatase family protein
Function (paralog2):BRI1 suppressor 1 (BSU1)-like 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.1662578744044
Log2 mRNA fold difference:3.42363352192
Log2 TE fold difference:-0.31851595477736
Sequences
Protein sequence

MAPDQSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSHQLILFGGSTTAVANH
NSSLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPRACHAAALYGTLILIQGGIGPS
GPSDGDVYMLDMTNNKWIKFLVGGETPSPRYGHVMDIAAQRWLVIFSGNNGNEILDDTWA
LDTRGPFSWDRLNPSGNQPSGRMYASGSSREDGIFLLCGGIDHSGVTLGDTYGLKMDSDN
VWTPVPAVAPSPRYQHTAVFGGSKLHVIGGILNRARLIDGEAVVAVLDTETGEWVDTNQP
ETSASGANRQNQYQLMRRCHHAAASFGSHLYVHGGIREDVLLDDLLVAETSQSSSPEPEE
DNPDNYMLLDDYLMDEPKPLSSEPEASSFIMRSTSEIAMDRLAEAHNLPTIENAFYDSAI
EGYVPLQHGAETVGNRGGLVRTASLDQSTQDLHKKVISTLLRPKTWTPPANRDFFLSYLE
VKHLCDEVEKIFMNEPTLLQLKVPIKVFGDIHGQYGDLMRLFHEYGHPSVEGDITHIDYL
FLGDYVDRGQHSLEIIMLLFALKIEYPKNIHLIRGNHESLAMNRIYGFLTECEERMGESY
GFEAWLKINQVFDYLPLAALLEKKVLCVHGGIGRAVTIEEIENIERPAFPDTGSMVLKDI
LWSDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHECVIDGFERFADG
RLITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISSSEEDYTDKAWMQELNI
EMPPTPARGESSE

MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG
SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMVVFQGGIGPA
GHSTDDLYVLDMTNDKFKWHRVVVQGDGPGPRYGHVMDLVSQRYLVTVTGNDGKRALSDA
WALDTAQKPYVWQRLNPDGDRPSARMYASGSARSDGMFLLCGGRDTLGAPLGDAYGLLMH
RNGQWEWTLAPGVAPSPRYQHAAVFVGARLHVSGGVLRGGRVIDAEASVAVLDTAAGVWL
DRNGQVTSARGSKGQIDQDPSFELMRRCRHGAASVGIRIYVHGGLRGDVLLDDFLVAENS
TFQSDISSPLLASDRTQQSSTPRFSYAARPPSGSEPSFSMSEGLSLDENSLEKLTEASAA
EAEVASSVWRAAQLGAGTLDEEPSTSDASSPIVESTTDGTANEGDVRLHPRAVVVAKETV
GSLGGMVRQLSLDQFQNESRRMVPMNNSDVPQPTKKFTRQKSPQGLHKKVIAALLRPRNW
KPPGNRKFFLDSYEVGELCYAAEQIFMHEQTVLQLKAPIKVFGDLHGQFGDLMRLFDEYG
FPSTAGDITYIDYLFLGDYVDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALF
GFRLECIERMGENDGIWAWTRFNQLFNYLPLAALIENKIICMHGGIGRSISTVEQIEKIE
RPITMDAGSLVLMDLLWSDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIR
AHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSP
ENSPEHSGDDAWMQELNIQRPPTPTRGRPQPDFDRSSLAYI

www.000webhost.com

Other information
Ka divergence:-0.768104KaKs divergence:-0.384122
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):2382Length 2 (bp):2646Length divergence:0.053
MFE 1 (kcal):-742.6MFE 2 (kcal):-879.99MFE divergence0.085