Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03457-AT4G03110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):RNA-binding protein-defense related 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.1570506164236
Log2 mRNA fold difference:1.3853741699255
Log2 TE fold difference:-0.23318302476458
Sequences
Protein sequence

MAEETMENEERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTC
PTREDADKVINSFHNKKTLPGASSPLQVKYADGELERLDVLDCSCNPEHKLFVGMLPKNV
SETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEALNGRHIMEGANV
PLIVKWADTEKERQARRLLKVQSHVSRLDPQNPSMFGALPMSYVPPYNGYGYHVPGTYGY
MLPPIQTQHAFHNVISPNQGNGRALQGTALTESVPPRLAPRRNFPTALGNYGYHGLQYPM
AFPRGMIPPRLPLTTVSPGISNNGTSIPSSLQTEGPAGANLFIYNIPREFEDQELAATFQ
PFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKRDNGQ
QQQQQQSKNPLFNGLLNS

MAEAKEENREKNEEEESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRG
CCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGELERLEHKLFVGMLPKNVSEA
EVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYETKEQAVSAMESINGKHKMEGSTVPLV
VKWADTERERHTRRLQKAQSHIARLGNGDPTNPSLFGALPMGYVPPYNGYGYHQPPGTYG
YMLPPIQNQAAFSNMIAQPNQGNNNALQGTSPDSVPPRLARRNFPMPPGNYMGSGYPAMR
GHPFPFAYPRGIVSPRPLSSSPGSISPGMSTPLGIGLSSVVQTEGPEGANLFIYNIPREF
GDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKL
KVQLKRDSNNGQPSSNPSLIS

www.000webhost.com

Other information
Ka divergence:-0.153986KaKs divergence:-0.198665
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1317Length 2 (bp):1326Length divergence:0.003
MFE 1 (kcal):-382.2MFE 2 (kcal):-390.64MFE divergence0.011