Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03520-AT4G03340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
Function (paralog2):Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1830008255796
Log2 mRNA fold difference:-1.2261694521625
Log2 TE fold difference:0.11611389315683
Sequences
Protein sequence

MRKLYRKLVSFRDPFARVKRHVSSHSGFRAFSDRKWLFPFLASLIMSITLLILLISGQFD
NFFGEEDQLPVDVVSESNDYFVESDFKQSMNSTADVNPEPPRLAYLISGTKGDSHRMMRT
LQAVYHPRNQYVLHLDLEAPPRERMELAMSVKTDPTFREMENVRVMAQSNLVTYKGPTMI
ACTLQAVSILLRESLHWDWFLNLSASDYPLVTQDDLLYVFSNLSRNVNFIENMQLTGWKL
NQRAKSIIVDPALYLSKKSDIAWTTQRRSLPNSFRLFTGSAWIMLTRSFLEYCIWGWDNF
PRTILMYYTNFVSSPEGYFHTVICNSKEFINTAIGHDLHYIAWDSPPKQHPRSLSLKDFD
NMVKSKAPFARKFHKNDPALDKIDKELLGRTHRFAPGGWCVGSSANGNDQCSVQGDDSVL
KPGPGSERLQELVQTLSSEEFRRKQCS

MKKVYRKLIWIRDPLARLKRHVSSHSGFRFFRDRKWMFPFLASLVLSVTLLMSVLYVQLE
TSYVEEPLPFDNLSEETNDYFVESQLRMSLNSTLDSTSSEVPRLAYLISGTKGDSLRMMR
TLQAVYHPRNQYVLHLDLEAPPKERLELAMSVKSDQTFREVENVRVMSQSNLVTYKGPTM
IACTLQAVAILLKESLDWDWFINLSASDYPLVTQDDMLYVFANLSRNVNFIEHMKLTGWK
LNQRAKSIIVDPGLYLSKKTEIAWTTQHRSLPTSFTLFTGSAWVVLTRSFLEYSILGWDN
FPRTILMYYTNFVSSPEGYFHTLICNTEEFKSTAIGHDLHYIAWDYPPKQHPNSLSMKDF
DKMVKSKAPFARKFHKNDPVLDKIDRELLGRTHRFSSGAWCIGSSENGADPCSVRGDDSA
LKPGPGAERLKELLQTLLSDEFRIKQCS

www.000webhost.com

Other information
Ka divergence:0.0903871KaKs divergence:0.353715
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1344Length 2 (bp):1347Length divergence:0.001
MFE 1 (kcal):-379.71MFE 2 (kcal):-401.35MFE divergence0.028