Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03610-AT4G03420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF789)
Function (paralog2):Protein of unknown function (DUF789)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3129852967343
Log2 mRNA fold difference:-0.74333082105136
Log2 TE fold difference:-0.35177071766012
Sequences
Protein sequence

MVNVKGSTKKSNLDRFLHCITPLVPPQSLPKTEIRTLNRLWHPWERQKVEFFRLSDLWDC
YDEWSAYGASVPIHVTNGESLVQYYVPYLSAIQIFTSHSSLIRLREESEDGECEGRDPFS
DSGSDESVSEEGLENNTLLHPSDRLGYLYLQYFERSAPYTRVPLMDKINELAQRYPGLMS
LRSVDLSPASWMSVAWYPIYHIPMGRTIKDLSTCFLTYHTLSSSFQDMEPEENGGDKERV
RREGEDITLLPFGMATYKMQGDVWLSQDHDDQERLASLYSVADSWLKQLRVQHHDFNYFC
NMSMTHRG

MVFGKGSNLDRFLHCTTPVVPPQSLSKAEIRSLNRIWHPWERQKVEFFRLSDLWDCYDEW
SAYGAGVPIRLSNGESLVQYYVPYLSAIQIFTSRSSLIRLRDDSEDGESRDSFSDSYSDE
SESDKLSRCASDEGLEHDALLHPNDRLGYLYLQYFERSAPYARVPLMDKINELAQRYPGL
MSLRSVDLSPASWMAVAWYPIYHIPMGRTIKDLSTCFLTYHTLSSSFQDMEPEENGGEKE
RIRKEGEGVTLLPFGLATYKMQGNVWLSEDDQGQDQERVLSLLSVADSWLKQLRVQHHDF
NYFSRMAHRG

www.000webhost.com

Other information
Ka divergence:-0.357844KaKs divergence:-0.394828
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):927Length 2 (bp):933Length divergence:0.003
MFE 1 (kcal):-289.72MFE 2 (kcal):-295.1MFE divergence0.009