Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03680-AT4G03520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):thioredoxin M-type 1
Function (paralog2):Thioredoxin superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.0540400681504
Log2 mRNA fold difference:1.7097213357029
Log2 TE fold difference:-0.67407085869991
Sequences
Protein sequence

MAAYTCTSRPPISIRSEMRIASSPTGSFSTRQMFSVLPESSGLRTRVSLSSLSKNSRVSR
LRRGVICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQK
YAGQFKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATSINKFL

MAAFTCTSRPPISLRSETRIVSSSPSASSLSSRRMFAVLPESSGLRIRLSLSPASLTSIH
QPRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLV
NDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIGAVPKTTLTSS
LDKFLP

www.000webhost.com

Other information
Ka divergence:-0.0210619KaKs divergence:0.695178
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):540Length 2 (bp):561Length divergence:0.019
MFE 1 (kcal):-160MFE 2 (kcal):-153.64MFE divergence-0.02