Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03700-AT4G03540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterised protein family (UPF0497)
Function (paralog2):Uncharacterised protein family (UPF0497)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.722139791832
Log2 mRNA fold difference:-1.0256021314048
Log2 TE fold difference:-0.80219753003294
Sequences
Protein sequence

MVKLTQRLGGLVLRFAAFCAALGAVIAMITSRERSSFFVISLVAKYSDLAAFKYFVIANA
IVTVYSFLVLFLPKESLLWKFVVVLDLMVTMLLTSSLSAAVAVAQVGKRGNANAGWLPIC
GQVPRFCDQITGALIAGLVALVLYVFLLIFSIHHVVDPFLLRKS

MVKLTKRIGGLVLRLAAFGAALAALIVMITSRERASFLAISLEAKYTDMAAFKYFVIANA
VVSVYSFLVLFLPKESLLWKFVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPIC
GQVPKFCDQITGALIAGFVALVLYVLLLLYSLHAVVDPFLLQKS

Other information
Ka divergence:-0.735257KaKs divergence:0.999837
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):495Length 2 (bp):495Length divergence:0
MFE 1 (kcal):-150.32MFE 2 (kcal):-165.4MFE divergence0.048