Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G03730-AT4G03600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9812504600797
Log2 mRNA fold difference:-1.6138185814386
Log2 TE fold difference:-0.36507065587222
Sequences
Protein sequence

MMDPTGSPRTSNGSPPRSYLIFMRIMSKRRTWVCLFVAVYAILLASSWNFLTSVLSWYKL
QYTSSPSPSRLPAVYASVVLGAVFGAMSMVAAAAVAVPAVMVIWISVVVLLAFFGKSRRV
LVVEARKITREVFGFVFKVLLKEGNAVAAVCAVLGYFILIRKDFDSI

MADQTESPRSYHIFITIMSKRRTWVCLFIAVYAILVSSSWNLLRSVLNWYKLQYTSSNSD
YSPSRLPAVYASVVLGAMFGAMSMVAAMTVAVPAVMVIWISVVVLLAFFGKSRRVLVVEG
RKITREVVGFVFKVLLKEGNVVAAFCAVLAYFLLIRRDFDSY

www.000webhost.com

Other information
Ka divergence:0.175851KaKs divergence:0.651919
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):504Length 2 (bp):489Length divergence:-0.015
MFE 1 (kcal):-158.5MFE 2 (kcal):-138.2MFE divergence-0.068