Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04490-AT2G33360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3527)
Function (paralog2):Protein of unknown function (DUF3527)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.117076620728
Log2 mRNA fold difference:3.0343608372288
Log2 TE fold difference:0.23187498665235
Sequences
Protein sequence

MEGQTHDAQNNVPEHDNPLMNVKNPSSNLFSKKDAQCLSVLCNGKWLQIVRSSPKVSCEA
STCPSHILTKVGENYVAESEKMHKKVISFSSKTFSQGTLQFTMRANGTPHFVFKLENQKD
VYVASLSSNVQDQNSYMIHLQRGESSASSSHLVGRINVSTLFSEKVLEREFVLFSSNGEN
LKIPRTRKNRGLSKKVVHAVKNERRTARLSRTSFIPDLGSWDEQFQAQNYDCLLKNKLPT
NLETLAVVVKQETIEDEIGGWGLKFLKRSPMFQRSNDASETETSTSSISMNVVIPSGIHG
GPEDGPSSLIERWKSQGNCDCGGWDLCCSLTLLKGQPRKDQYFELFIEGSKHETTGLKIV
NVSGGLYLVQFEAKLTSLQSFAIALAFIHSEKLRPLHLYVF

MGSVSPDAQKDDLELEDSLNIDENLSGGNGLLKSGNLLSQKRQQCSLVSNSGKWLQIVKN
GPKGSFSRATSFFDNKIPRQLVSVDEKYLRRCLDLINISAFKSASCSLSLNLVGSKMSLS
SRRFDLPVIPKENVARLVFDLPLVDDSGSPVISRAIIGCKRVTYMLDKPTLHSLEALDGD
GNNIGTRRDHNGESELVSYDVVRKIEEKNTPDSQFLSYHSGNMPRKAVSLSSTNSLSSSS
SEQSSSSWSPSSSVSQGTLQFTMKDNKTPHFVFSLDDQKEIYVASLSTTSVGSGFDRSSL
DYSYLIHLKKGRGSEPQHLVGKLKVSTLFSVSSTNEKTVERQFVLFSSGGNPQLPCHKDI
RKNRGLPKKVVDALKSTKRTSRQRSISRFSRTSSIPDFCSWEPFQEHDSDLEPISLLDND
LPPNLETSAVVVREQFPVEEEEEEEVEKVGGWGMKFLKKIPLARTKDASKCSKHSTSIDV
VIPLGIHGGPRNRNGGPSSLIQRWKSGGCCDCSGWDLGCPLTVLKGQARKDQSEGQCNLF
ELFTEGLMQGSPGLRIMNVRDGLYFVQSQAKISVLQSFSIALAYIHSQSQRLRPWSSKKC
TEA

www.000webhost.com

Other information
Ka divergence:-0.269972KaKs divergence:0.127354
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):1206Length 2 (bp):1812Length divergence:0.201
MFE 1 (kcal):-336.06MFE 2 (kcal):-551.21MFE divergence0.242