Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04510-AT2G33340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MOS4-associated complex 3A
Function (paralog2):MOS4-associated complex 3B

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.29502197900304
Log2 mRNA fold difference:0.22733969689691
Log2 TE fold difference:0.068595179471848
Sequences
Protein sequence

MNCAISGEVPEEPVVSKKSGLLYEKRLIQTHISDYGKCPVTGEPHTLDDIVPIKTGKIVK
PKPLHTASIPGLLGTFQTEWDSLMLSNFALEQQLHTARQELSHALYQHDAACRVIARLKK
ERDESRQLLAEAERQLPAAPEVATSNAALSNGKRGIDDGEQGPNAKKMRLGISAEVITEL
TDCNAALSQQRKKRQIPKTLASVDALEKFTQLSSHPLHKTNKPGIFSMDILHSKDVIATG
GIDTTAVLFDRPSGQILSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIWGCSEDGNYT
SRHTLKDHSAEVRAVTVHATNKYFVSASLDSTWCFYDLSSGLCLAQVTDASENDVNYTAA
AFHPDGLILGTGTAQSIVKIWDVKSQANVAKFGGHNGEITSISFSENGYFLATAALDGVR
LWDLRKLKNFRTFDFPDANSVEFDHSGSYLGIAASDIRVFQAASVKAEWNPIKTLPDLSG
TGKATSVKFGLDSKYIAVGSMDRNLRIFGLPDDDNTEDSAQDS

MNCAISGEVPVEPVVSTKSGLLFERRLIERHISDYGKCPVTGEPLTIDDIVPIKTGEIIK
PKTLHTASIPGLLGTFQNEWDGLMLSNFALEQQLHTARQELSHALYQHDSACRVIARLKK
ERDEARQLLAEVERHIPAAPEAVTANAALSNGKRAAVDEELGPDAKKLCPGISAEIITEL
TDCNAALSQKRKKRQIPQTLASIDTLERFTQLSSHPLHKTNKPGICSMDILHSKDVIATG
GVDATAVLFDRPSGQILSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWRNPGDGNYA
CGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCFYDLSSGSCLAQVSDDSKNVDYTAAA
FHPDGLILGTGTSQSVVKIWDVKSQANVAKFDGHTGEVTAISFSENGYFLATAAEDGVRL
WDLRKLRNFKSFLSADANSVEFDPSGSYLGIAASDIKVYQTASVKAEWNLIKTLPDLSGT
GKATCVKFGSDAQYVAVGSMDRNLRIFGLPGDEKANVDDDSAQDS

www.000webhost.com

Other information
Ka divergence:0.0550124KaKs divergence:-0.0385802
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1572Length 2 (bp):1578Length divergence:0.002
MFE 1 (kcal):-490.24MFE 2 (kcal):-481MFE divergence-0.01