Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04520-AT2G33330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasmodesmata-located protein 2
Function (paralog2):plasmodesmata-located protein 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2101639452222
Log2 mRNA fold difference:0.90396968268506
Log2 TE fold difference:0.19192061884094
Sequences
Protein sequence

MGLSISFLSIIMMMCLLFPDLNVVVKSATTEYTTLIYKGCARQQFSDPSGLYSQALSAMF
GSLVSQSTKTRFYKTTTGTSTTTITGLFQCRGDLSNHDCYNCVSRLPVLSDKLCGKTIAS
RVQLSGCYLLYEVSGFSQISGMEMLFKTCGKNNIAGTGFEERRDTAFGVMQNGVVSGHGF
YATTYESVYVLGQCEGDVGDTDCSGCVKNALEKAQVECGSSISGQIYLHKCFIAYSYYPN
GVPRRSSSSSSSSSSSSSGSSNSDPSTSTGATGKTVAIIVGGAAGVGFLVICLLFAKNLM
RKKHDDY

MGFYSLKQLLLLYIIIMALFSDLKLAKSSSPEYTNLIYKGCARQRLSDPSGLYSQALSAM
YGLLVTQSTKTRFYKTTTGTTSQTSVTGLFQCRGDLSNNDCYNCVSRLPVLSGKLCGKTI
AARVQLSGCYLLYEISGFAQISGMELLFKTCGKNNVAGTGFEQRRDTAFGVMQNGVVQGH
GFYATTYESVYVLGQCEGDIGDSDCSGCIKNALQRAQVECGSSISGQIYLHKCFVGYSFY
PNGVPKRSSPYPSSGSSGSSSSSSSSGTTGKTVAIIVGGTAGVGFLVICLLFVKNLMKKK
YDDY

www.000webhost.com

Other information
Ka divergence:0.238807KaKs divergence:-0.999786
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):924Length 2 (bp):915Length divergence:-0.005
MFE 1 (kcal):-276.22MFE 2 (kcal):-264.84MFE divergence-0.021