Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G04540-AT2G33320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-dependent lipid-binding (CaLB domain) family protein
Function (paralog2):Calcium-dependent lipid-binding (CaLB domain) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.6130350335214
Log2 mRNA fold difference:2.5918152586742
Log2 TE fold difference:0.11424551436557
Sequences
Protein sequence

MSMMFPSFQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKF
VFRVNEEFLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRT
PPPGMRFVALQVRRTSGRPQGILNIGVGLIDGSMRSMPLYTHMDSSAVGYRDLLGEEDHH
LQHLHLNSNKGSSKNPQSPSSRQYQSVISRPELRRTKSDTSSMVVSDLLSRAERSRLANR
QPASAIVSSESETLPTTTDSDEKKSSEYTPPSKNLRVPRQRYNSIESDLINPSPMENHHV
VVSRRERHDVMPYSSYQQTGKTPRKKTRIEKQRSVKDYDRGRASPYLSKHGTPLRSNIIA
STPMRSNGVGSTPMRSNIIAMSPMHPNMVGSTPMRTPMRSNMVGSTPMRSNIVGSTPIRS
NYMATPMRTHHDFGTPVRNLAGRRILTESELGPSPSEVADKLAKDRSHETESSILSEWSI
DESSIEGLRSKLERWRTELPPLYDIGSSHISSTDYDGASVPAATAGGGMSSRRKTPTTKK
HNRRHTDGGNGLFSCFSKICGVECSFVCGGGGGPMVSEGSTKKGGAGRVQRTYSADDLSF
V

MSIFPSFQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFV
FRVSEDFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPP
PGMRFVALQVRRPSGRPQGILNIGVGILDGSMRSMPLYTNMDSSAVGYRDLLGEEDPNLQ
NLHLNSFKGSSKNPQSPSSKQYQSVVSRPPMLRRTRSDTSSMVVSDLLSRVERSRVANRK
PASALMSAESETVPTTTGHDSVTSDSELTKSIEYALPYQSPKIPSQGYDSYEPDFIDQSP
NHNVLRPRSERQHEPDFIDQSPFRSNDRSRKTPRRSTPMIEKPRPPRDYDRTSSRASPYL
SRHGTPLRSNIVASTPIRSNMVSSSPMRSTGVGSTPRRSNILGSTPLRSNIVGSTPIRSN
YKATPMKSPMQFGTPMRSNLAGRPVLTESELGPSPSEVAQKMAKERSQAYETESSILSEW
SLDDDSNIEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAMVVANVGGGKSSRKKTPAV
KKKHNRRHTEGGGNGLFSCFSNLCGVECTFVCGGGSDQDGSKKKGGSGRLPRLGSADDLS
YL

www.000webhost.com

Other information
Ka divergence:0.197698KaKs divergence:-0.753586
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1806Length 2 (bp):1809Length divergence:0.001
MFE 1 (kcal):-548.11MFE 2 (kcal):-547.95MFE divergence0